Entry information : HanPrxQ02
Entry ID 6638
Creation 2009-03-22 (Christophe Dunand)
Last sequence changes 2011-12-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-23 (Catherine Mathe (Scipio))
Peroxidase information: HanPrxQ02
Name HanPrxQ02
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer Infected host
Repressor N/D
Best BLASTp hits
Perox score E-value HanPrxQ02
start..stop
S start..stop
PplPrxQ02 261 2e-88 122..274 76..228
CcinPrxQ 255 4e-86 120..276 76..232
LbiPrxQ02 252 5e-85 76..271 2..224
AthiPrxQ 232 1e-76 125..274 98..247
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 141758..142072 315 N° 2 141493..141682 190 N° 3 141309..141434 126 N° 4 141088..141238 151
N° 5 140958..141012 55  
complement(join(140958..141012,141088..141238,141309..141434,141493..141682,1417 58..142072))


exon

Literature and cross-references HanPrxQ02
Literature Karlsson,M., Olson,A. and Stenlid,J. Expressed sequences from the basidiomycetous tree pathogen Heterobasidion annosum during early infection of Scots pine. Fungal Genet. Biol. 39 (1), 51-59 (2003)
DNA ref. JGI genome:   scaffold_13 (142072..140958)
EST ref. GenBank:   BM347166.1 [Fragment]
Protein sequence: HanPrxQ02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   278
PWM (Da):   %s   29614.33  
PI (pH):   %s   8.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFPSVIASRQCAIVRSKAGLLEPKPSWSRTPSNGIRPIIIPSVPGGLLQLARPRPSLLDNPTSTLTTTTTISLFSPPNRFFATNMSDAPRRSARLAGNGTAAVSETPAADPAPKIVPAEEDVAELAKIDLGDSLPSLTLQNEKGEDIDVASLAAEKGVVMFLVPKADTAGCTTQACGFRDVYPDFTEHNFDVYCLSADSPSAQTKWQTKAQLPYPLISDPDRLLIAALGAKENGKTKRSHFIFEKGGKLVDKRNPVTPTESPPAALEFVKSYNTKASL

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 1 EST. Strain="TC 32-1 (P)".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCCGTCAGTGATAGCCTCACGCCAGTGTGCGATTGTGCGATCCAAGGCTGGGCTTCTGGAGCCCAAACCCAGCTGGTCGCGGACACCCTCCAACGGGATTCGGCCCATTATAATC
CCTTCAGTACCCGGTGGATTACTACAGCTTGCACGCCCACGACCGAGCTTGCTTGATAACCCTACCAGCACTCTTACCACCACCACTACCATCTCCCTCTTCTCCCCTCCAAACCGCTTT
TTCGCGACGAATATGTCCGACGCACCAAGACGTTCAGCGCGACTCGCCGGAAACGGCACCGCAGCCGTATCAGAG
GTGCGTTCTTAGATCATTTACACACCAACTCGTCGACGTGACATC
AGATCTAATATCATCAACGTACATCCATAGACGCCAGCTGCTGATCCTGCACCAAAGATCGTCCCAGCAGAGGAGGACGTGGCGGAGCTCGCAAAGATAGATCTGGGCGATAGCCTCCCG
TCGCTGACGCTGCAGAACGAGAAGGGCGAGGACATCGACGTCGCGAGCCTCGCCGCCGAGAAGGGCGTTGTGATGTTCCTGGTGCCCAAAGCCGATACCG
GTGAGTCGCGCGTTTGATCC
CCCGCTCTGTTCGGGTCTCTCATCGATCACGGCGCTAGCGGGATGCACGACGCAGGCGTGCGGGTTCCGGGACGTCTACCCCGACTTCACCGAGCACAACTTTGATGTCTACTGCCTGAG
CGCAGATTCTCCTAGCGCGCAGACCAAATGGCAGACCAAGGCAC
GTACCTCTTCCCCTTTTCGCTTTTTTTCGCCCTAAACTATGTCACTCACATACGTTCTCTCTACAGAAAGAGCTTC
CCTACCCCCTCATCTCCGACCCCGACCGCCTCCTCATCGCTGCTCTCGGCGCCAAAGAGAACGGCAAGACGAAGCGCAGCCACTTCATTTTCGAGAAGGGCGGCAAGCTCGTCGACAAGC
GCAACCCCGTCACGCCCACCGAGAG
GTGCGTACCTCCCTTTATTTCTATTTTTCTGTCTATGCGCGCCTTTGTCCGGATCCTGATTCTTCCTTCTAACAGCCCGCCTGCCGCCCTGGAGT
TCGTCAAGAGCTACAACACCAAAGCTTCGCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCCGTCAGTGATAGCCTCACGCCAGTGTGCGATTGTGCGATCCAAGGCTGGGCTTCTGGAGCCCAAACCCAGCTGGTCGCGGACACCCTCCAACGGGATTCGGCCCATTATAATC
CCTTCAGTACCCGGTGGATTACTACAGCTTGCACGCCCACGACCGAGCTTGCTTGATAACCCTACCAGCACTCTTACCACCACCACTACCATCTCCCTCTTCTCCCCTCCAAACCGCTTT
TTCGCGACGAATATGTCCGACGCACCAAGACGTTCAGCGCGACTCGCCGGAAACGGCACCGCAGCCGTATCAGAG
ACGCCAGCTGCTGATCCTGCACCAAAGATCGTCCCAGCAGAGGAG
GACGTGGCGGAGCTCGCAAAGATAGATCTGGGCGATAGCCTCCCGTCGCTGACGCTGCAGAACGAGAAGGGCGAGGACATCGACGTCGCGAGCCTCGCCGCCGAGAAGGGCGTTGTGATG
TTCCTGGTGCCCAAAGCCGATACCG
CGGGATGCACGACGCAGGCGTGCGGGTTCCGGGACGTCTACCCCGACTTCACCGAGCACAACTTTGATGTCTACTGCCTGAGCGCAGATTCTCCT
AGCGCGCAGACCAAATGGCAGACCAAGGCAC
AGCTTCCCTACCCCCTCATCTCCGACCCCGACCGCCTCCTCATCGCTGCTCTCGGCGCCAAAGAGAACGGCAAGACGAAGCGCAGCCAC
TTCATTTTCGAGAAGGGCGGCAAGCTCGTCGACAAGCGCAACCCCGTCACGCCCACCGAGAG
CCCGCCTGCCGCCCTGGAGTTCGTCAAGAGCTACAACACCAAAGCTTCGCTGTGA

Retrieve as FASTA