Entry information : Gz2CysPrx
Entry ID 6639
Creation 2009-03-23 (Christophe Dunand)
Last sequence changes 2009-03-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: Gz2CysPrx
Name Gz2CysPrx
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Gz2CysPrx
start..stop
S start..stop
Athi2CysPrx01 321 3e-113 4..212 3..217
Pc2CysPrx01-1 315 4e-111 4..212 3..211
Lbi2CysPrx 315 4e-111 4..212 3..219
Pcar2CysPrx01-1 315 8e-111 4..212 3..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4340411..4340517 107 N° 2 4340576..4341107 532  
join(4340411..4340517,4340576..4341107)


exon

Literature and cross-references Gz2CysPrx
Literature Watson,R.J., Heys,R., Couroux,P., De Moors,A., Harris,L.J., Hattori ,J., Lacroix,C., Masotti,M., Ouellet,T., Robert,L.S., Singh,J.A., Sprott,D. and Tinker,N.A. A cDNA library prepared from Fusarium graminearum grown on a simple substrate
DNA ref. JGI genome:   Supercontig_3.2 (4340411..4341107)
EST ref. GenBank:   CD459347.2 [3' end]
Protein sequence: Gz2CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   95
PWM (Da):   %s   10690.37  
PI (pH):   %s   6.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQAFVQRPAPEFTATTLFPGGEFKDIKLSDYQGQWVVLLFYPMDFTFVCPTEIIQYNNALDRFKEINTTVFGVSTDSHFTHLAWVEKPRKQGGLGPDLELPLIADKSTKISRNYGVLIEDEGIALRGLFIIDPKGVLRQITVNDLPVGRDVEETIRLVKAFQFTDEYGEVCPAGWQEGGKTMKADPKGSLEYFSAQGENGESESRKRPRTD

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 1 intron) and 5 ESTs. Strain="PH-1".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCAAGCTTTCGTTCAGCGCCCTGCGCCCGAGTTCACTGCCACTACCCTCTTCCCCGGAGGCGAGTTCAAGGACATCAAGCTCTCTGACTACCAGGGACAATGGTAAGAGACAACA
CCAAACACCTTGATGGTTTGGGTCTTTGCTAACTTGTTTTTGTAGGGTCGTCCTCCTGTTCTACCCCATGGACTTCACCTTTGTCTGCCCTACCGAGATCATCCAGTACAACAACGCCCT
CGACCGCTTCAAGGAGATCAACACCACCGTCTTCGGTGTCTCCACCGACTCCCACTTCACCCATCTTGCCTGGGTTGAGAAGCCTCGCAAGCAGGGTGGTCTCGGTCCCGACCTGGAGCT
CCCCCTCATCGCCGACAAGTCCACCAAGATCTCTCGCAACTACGGCGTCCTGATCGAGGACGAGGGCATCGCTCTCCGCGGTCTCTTCATCATCGACCCCAAGGGTGTCCTCCGCCAGAT
CACCGTCAACGACCTTCCCGTCGGCCGCGACGTCGAGGAGACCATCCGTCTCGTCAAGGCCTTCCAGTTCACCGACGAGTACGGCGAGGTGTGCCCTGCTGGCTGGCAGGAGGGCGGAAA
GACCATGAAGGCCGACCCCAAGGGCAGCCTCGAGTACTTTTCCGCCCAGGGAGAGAATGGTGAGTCTGAGTCTCGCAAGCGACCCAGGACTGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCAAGCTTTCGTTCAGCGCCCTGCGCCCGAGTTCACTGCCACTACCCTCTTCCCCGGAGGCGAGTTCAAGGACATCAAGCTCTCTGACTACCAGGGACAATGGGTCGTCCTCCTG
TTCTACCCCATGGACTTCACCTTTGTCTGCCCTACCGAGATCATCCAGTACAACAACGCCCTCGACCGCTTCAAGGAGATCAACACCACCGTCTTCGGTGTCTCCACCGACTCCCACTTC
ACCCATCTTGCCTGGGTTGAGAAGCCTCGCAAGCAGGGTGGTCTCGGTCCCGACCTGGAGCTCCCCCTCATCGCCGACAAGTCCACCAAGATCTCTCGCAACTACGGCGTCCTGATCGAG
GACGAGGGCATCGCTCTCCGCGGTCTCTTCATCATCGACCCCAAGGGTGTCCTCCGCCAGATCACCGTCAACGACCTTCCCGTCGGCCGCGACGTCGAGGAGACCATCCGTCTCGTCAAG
GCCTTCCAGTTCACCGACGAGTACGGCGAGGTGTGCCCTGCTGGCTGGCAGGAGGGCGGAAAGACCATGAAGGCCGACCCCAAGGGCAGCCTCGAGTACTTTTCCGCCCAGGGAGAGAAT
GGTGAGTCTGAGTCTCGCAAGCGACCCAGGACTGATTAA

Retrieve as FASTA