Entry information : GzPrxQ
Entry ID 6640
Creation 2009-04-04 (Christophe Dunand)
Last sequence changes 2012-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-24 (Christophe Dunand)
Peroxidase information: GzPrxQ
Name GzPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzPrxQ
start..stop
S start..stop
PnoPrxQ01 256 1e-86 1..235 1..220
LbiPrxQ02 103 2e-27 13..234 12..225
PcarPrxQ02 101 8e-27 18..217 26..204
PplPrxQ02 102 9e-27 71..234 67..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1452367..1452775 409 N° 2 1452827..1453143 317  
join(1452367..1452775,1452827..1453143)


exon

Literature and cross-references GzPrxQ
Literature Schernthaner,J.P., Piche,C., Ouellet,T., Bily,A., Harris,L.J., Couroux,P., De Moors,A., Hattori,J.I., Lacroix,C., Masotti,M., Robert,L.S., Singh,J.A., Sprott,D. and Tinker,N.A. Expressed Sequence Tags from Fusarium graminearum mycelium II. Unpublished (2004).
DNA ref. JGI genome:   Supercontig_3.7 (1452367..1453143)
Protein sequence: GzPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   241
PWM (Da):   %s   25826.61  
PI (pH):   %s   8.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPVELRKRKAPAAPPPPPVKRKATGKTGKAAKAKEAAAKVAEKEDNPEKVEEPKEETKEEAKEEEKTEEEPKTEEPKAQEAKKSGGKVEVGDIVDLDTFGGEIETNDGDKTTLKKLVDESKSGVVLFTYPKASTPGCTKQVCFFRDSYEPLTKDGLAIYGLSTDSPKANTTFKEKQKLPYPLLCDPKATLIGAIGLKKAPKGTTRGVFVISKEGKVLVAEAGSPQGTMDRVKALVEELASK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 1 introns) and 5 ESTs. Strain="PH-1".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTTGAACTTCGTAAGCGCAAGGCGCCTGCTGCCCCTCCCCCTCCTCCTGTGAAGAGAAAGGCCACTGGAAAGACCGGAAAGGCTGCCAAGGCGAAGGAGGCTGCTGCAAAGGTC
GCAGAGAAGGAGGACAATCCTGAAAAGGTAGAGGAGCCCAAGGAGGAAACCAAGGAGGAAGCTAAGGAAGAGGAGAAGACTGAGGAGGAGCCCAAGACTGAGGAGCCCAAGGCGCAAGAA
GCAAAGAAGTCGGGCGGCAAGGTCGAGGTTGGCGACATTGTGGACCTTGATACCTTTGGAGGCGAGATTGAGACCAACGATGGCGACAAGACCACCTTGAAGAAGCTCGTTGATGAGAGC
AAGTCTGGCGTCGTTCTCTTCACCTACCCCAAGGCATCTACTCCTGGTT
GTAAGTTTTCCATTACCGTCCCATCCGAATTCCCATCTAACTCCTCCACAGGCACAAAGCAGGTCTGCTTC
TTCCGCGACTCATACGAGCCTCTCACCAAGGACGGTCTGGCTATCTACGGTCTCAGCACCGACTCTCCCAAGGCCAACACAACCTTCAAGGAGAAGCAAAAGCTCCCTTACCCACTATTG
TGCGACCCTAAGGCTACCCTTATCGGCGCCATCGGTCTCAAGAAGGCGCCCAAGGGAACGACGCGTGGTGTCTTTGTGATTAGCAAGGAGGGCAAGGTCCTCGTCGCTGAGGCGGGAAGC
CCACAGGGTACTATGGACCGTGTGAAGGCTCTCGTTGAAGAGTTGGCTAGCAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTTGAACTTCGTAAGCGCAAGGCGCCTGCTGCCCCTCCCCCTCCTCCTGTGAAGAGAAAGGCCACTGGAAAGACCGGAAAGGCTGCCAAGGCGAAGGAGGCTGCTGCAAAGGTC
GCAGAGAAGGAGGACAATCCTGAAAAGGTAGAGGAGCCCAAGGAGGAAACCAAGGAGGAAGCTAAGGAAGAGGAGAAGACTGAGGAGGAGCCCAAGACTGAGGAGCCCAAGGCGCAAGAA
GCAAAGAAGTCGGGCGGCAAGGTCGAGGTTGGCGACATTGTGGACCTTGATACCTTTGGAGGCGAGATTGAGACCAACGATGGCGACAAGACCACCTTGAAGAAGCTCGTTGATGAGAGC
AAGTCTGGCGTCGTTCTCTTCACCTACCCCAAGGCATCTACTCCTGGTT
GCACAAAGCAGGTCTGCTTCTTCCGCGACTCATACGAGCCTCTCACCAAGGACGGTCTGGCTATCTACGGT
CTCAGCACCGACTCTCCCAAGGCCAACACAACCTTCAAGGAGAAGCAAAAGCTCCCTTACCCACTATTGTGCGACCCTAAGGCTACCCTTATCGGCGCCATCGGTCTCAAGAAGGCGCCC
AAGGGAACGACGCGTGGTGTCTTTGTGATTAGCAAGGAGGGCAAGGTCCTCGTCGCTGAGGCGGGAAGCCCACAGGGTACTATGGACCGTGTGAAGGCTCTCGTTGAAGAGTTGGCTAGC
AAGTGA

Retrieve as FASTA