Entry information : ZmPrx121
Entry ID 6682
Creation 2009-04-09 (Christophe Dunand)
Last sequence changes 2009-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx121
Name ZmPrx121
Class Class III peroxidase    [Orthogroup: Prx189]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx121
start..stop
S start..stop
SbPrx56 614 0 1..333 1..334
SiPrx24 523 0 19..333 22..311
OsPrx06 514 0 16..333 15..336
BdiPrx58 473 1e-169 12..333 15..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51165620..51165859 240 N° 2 51165963..51166724 762  
join(51165620..51165859,51165963..51166724)


exon

Literature and cross-references ZmPrx121
DNA ref. GenBank:   AC209973.3 (86856..87960)
Protein sequence: ZmPrx121
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (305)
PWM (Da):   %s   36382.63 (33442.0)  
PI (pH):   %s   9.82 (9.32) Peptide Signal:   %s   cut: 29 range:29-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRSSTRVAQLAALTILLSWIAVSSVASSESEAPLQVGYYSRTCPRAEDLVRNVVRAAIRRDPGNGPGLVRLFFHDCFVRGCDASVLLDAAPGSNASTVEKASQANNPSLRGFSVINRAKRVLERRCRRTVSCADIVAFAARDACGILGGIDFAMPAGRRDGRVSNASEVLNNLPGPFTNVQLLVASFAAKNLTADDMVILSGAHSFGRSHCSAFSFRLYPQIAEDMNATYGRYLRTRCPAATGRRDRVVDLDQRTELLLDNQYYKNVQTREVLFTSDVTLLSQNDTAALVDLYARNRTLWASRFASAMVKMGHLDVLTGTQGEIRKFCNRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1). No EST. Also found in AC217436.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGAAGCAGCACTCGTGTTGCTCAGCTTGCTGCTCTAACCATCCTGCTGTCGTGGATCGCCGTCTCCTCTGTCGCATCATCGGAGTCGGAGGCCCCCTTACAAGTCGGTTACTAC
AGCCGCACTTGCCCACGAGCAGAGGATCTCGTCCGCAACGTTGTCCGCGCCGCCATCCGCCGTGACCCCGGCAATGGACCAGGCCTCGTGCGCCTCTTCTTCCACGATTGCTTCGTCAGG
GTAAGCAACAAGCCGTTGGCATCTACCCAAACGGATTGACCAATCCGCACTGTGTGTCTGCAGAATCATGGCAAGCACTCCGAGCTTATCGTGCACTTTGCAGGGGTGTGACGCGTCGGT
GCTGCTGGATGCGGCACCCGGCAGCAACGCCAGCACGGTGGAGAAGGCGTCGCAGGCCAACAACCCCAGCCTCCGCGGGTTCAGCGTCATCAACCGCGCGAAGCGCGTGCTGGAGCGCCG
GTGCCGGAGGACCGTATCCTGCGCCGACATCGTCGCCTTCGCCGCCCGCGACGCCTGCGGCATCCTGGGCGGGATCGACTTCGCCATGCCGGCGGGGAGACGCGACGGCCGTGTCTCCAA
TGCGTCCGAGGTGCTCAACAACCTTCCGGGGCCATTCACCAACGTCCAGCTGCTCGTCGCCTCCTTCGCCGCCAAGAACCTCACCGCCGACGACATGGTCATCCTCTCCGGCGCCCACTC
CTTCGGCCGCTCCCACTGCTCCGCTTTCTCCTTCCGGCTCTACCCTCAGATCGCCGAGGACATGAACGCCACCTACGGCAGGTACCTCAGGACGCGGTGCCCCGCGGCGACGGGGCGACG
CGACCGGGTGGTGGACCTGGACCAGAGGACGGAGCTCCTGCTCGACAACCAGTACTACAAGAACGTGCAGACGCGCGAGGTGCTCTTCACGTCGGACGTCACCCTGCTCAGCCAGAACGA
TACGGCGGCGCTAGTCGACCTCTACGCGCGCAACCGGACGCTCTGGGCCTCGCGGTTCGCGTCCGCCATGGTGAAGATGGGCCACCTCGACGTGCTCACCGGCACCCAAGGAGAGATAAG
GAAATTTTGCAACAGAGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGAAGCAGCACTCGTGTTGCTCAGCTTGCTGCTCTAACCATCCTGCTGTCGTGGATCGCCGTCTCCTCTGTCGCATCATCGGAGTCGGAGGCCCCCTTACAAGTCGGTTACTAC
AGCCGCACTTGCCCACGAGCAGAGGATCTCGTCCGCAACGTTGTCCGCGCCGCCATCCGCCGTGACCCCGGCAATGGACCAGGCCTCGTGCGCCTCTTCTTCCACGATTGCTTCGTCAGG
GGGTGTGACGCGTCGGTGCTGCTGGATGCGGCACCCGGCAGCAACGCCAGCACGGTGGAGAAGGCGTCGCAGGCCAACAACCCCAGCCTCCGCGGGTTCAGCGTCATCAACCGCGCGAAG
CGCGTGCTGGAGCGCCGGTGCCGGAGGACCGTATCCTGCGCCGACATCGTCGCCTTCGCCGCCCGCGACGCCTGCGGCATCCTGGGCGGGATCGACTTCGCCATGCCGGCGGGGAGACGC
GACGGCCGTGTCTCCAATGCGTCCGAGGTGCTCAACAACCTTCCGGGGCCATTCACCAACGTCCAGCTGCTCGTCGCCTCCTTCGCCGCCAAGAACCTCACCGCCGACGACATGGTCATC
CTCTCCGGCGCCCACTCCTTCGGCCGCTCCCACTGCTCCGCTTTCTCCTTCCGGCTCTACCCTCAGATCGCCGAGGACATGAACGCCACCTACGGCAGGTACCTCAGGACGCGGTGCCCC
GCGGCGACGGGGCGACGCGACCGGGTGGTGGACCTGGACCAGAGGACGGAGCTCCTGCTCGACAACCAGTACTACAAGAACGTGCAGACGCGCGAGGTGCTCTTCACGTCGGACGTCACC
CTGCTCAGCCAGAACGATACGGCGGCGCTAGTCGACCTCTACGCGCGCAACCGGACGCTCTGGGCCTCGCGGTTCGCGTCCGCCATGGTGAAGATGGGCCACCTCGACGTGCTCACCGGC
ACCCAAGGAGAGATAAGGAAATTTTGCAACAGAGTGAACTAG

Retrieve as FASTA