Entry information : ZmPrx123
Entry ID 6684
Creation 2009-04-09 (Christophe Dunand)
Last sequence changes 2009-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx123
Name ZmPrx123
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx123
start..stop
S start..stop
SbPrx74 576 0 1..324 1..326
SiPrx77 535 0 2..323 3..320
HvPrx13 510 0 7..323 9..322
OsPrx30 503 0 1..324 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 228852226..228852444 219 N° 2 228852555..228852746 192 N° 3 228852833..228853396 564  
join(228852226..228852444,228852555..228852746,228852833..228853396)


exon

Literature and cross-references ZmPrx123
Literature Genoplante.
Protein ref. UniProtKB:   B4FA32
DNA ref. GenBank:   AC184855.3 (39291..38121)
mRNA ref. GenBank:   BT033970   NM_001137194
Cluster/Prediction ref. UniGene:   Zm.39078
Protein sequence: ZmPrx123
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (299)
PWM (Da):   %s   33901.13 (31242.8)  
PI (pH):   %s   6.96 (6.24) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFRTSWHCLLAACLFLLASAAHGQQLSSSFYAATCPTLELIVRTTMLTALLAERRMGASLVRLFFHDCFVQGCDGSILLDDVGSFVGEKGAGPNVNSLRGFDVIDQIKANVELICPGVVSCADIVALAARDGTFLLGGPSWAVPLGRRDSTTASLALANSDLPSPVSGLAALLAAFGNKGLGPGDLTALSGAHTIGFSQCQNFRAHIYNDTDIDPAFASLRQRTCPAAPGTGDSSLAPLDVQTQLVFDNAYYRNLLAKRGLLRSDQALFNGGSQDALVRQYSANPALFASDFANAMIKMGNISPLTGTAGQIRANCRVVNSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTCCGGACCAGCTGGCATTGCTTGCTCGCCGCCTGCCTGTTCCTGCTCGCTTCGGCGGCGCACGGGCAGCAGCTCTCGTCGTCCTTCTACGCGGCGACATGCCCGACGCTG
GAGCTCATCGTGCGGACCACCATGCTCACGGCGCTCCTCGCCGAGCGTCGGATGGGCGCGTCCCTCGTCAGGCTCTTCTTCCACGACTGCTTTGTCCAA
GTACGTACACGCCATTAACCT
ATATATATATACCAGCACGCAGTCGTGAATGAATCATTCGCATATATAATATAACTACGTATATATATACTGGCACGCCACCACACCAGGGCTGCGACGGCTCCATTCTTCTGGACGACG
TCGGCAGCTTCGTCGGCGAGAAGGGCGCCGGCCCCAACGTCAACTCTCTCCGCGGCTTCGACGTGATCGACCAGATCAAGGCCAACGTCGAGCTCATCTGCCCCGGCGTTGTCTCCTGCG
CCGACATTGTCGCCCTCGCCGCGCGAGACGGCACCTTCTTG
GTAAGTACATACGTTACGTACGTACGTAGATAGATGAACCGACTCCATCACTACTTACTGCTGCTCCGATCCGCATCAT
CGGTCAGCTCGGAGGACCAAGCTGGGCGGTGCCGCTGGGCCGGCGCGACTCGACCACGGCGAGCCTGGCCCTGGCCAACAGCGACCTGCCGTCGCCGGTCTCCGGCCTCGCCGCTCTCCT
CGCAGCGTTCGGCAACAAGGGCCTGGGGCCCGGGGACCTGACGGCGCTCTCGGGCGCGCACACCATCGGCTTCTCGCAGTGCCAGAACTTCCGCGCCCACATCTACAACGACACCGACAT
CGACCCGGCGTTCGCCAGCCTGCGCCAGCGCACCTGCCCCGCCGCGCCGGGCACCGGGGACAGCAGCCTGGCGCCGCTCGACGTGCAGACGCAGCTCGTCTTCGACAACGCCTACTACCG
CAACCTGCTGGCCAAGCGCGGCCTGCTGCGCTCCGACCAGGCGCTCTTCAACGGCGGCTCCCAGGACGCGCTGGTGCGCCAGTACAGTGCCAACCCGGCCCTCTTCGCCTCAGACTTCGC
CAACGCCATGATAAAGATGGGCAACATCAGCCCGCTCACCGGAACCGCGGGCCAGATCAGGGCAAACTGTAGGGTGGTCAACAGCAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTCCGGACCAGCTGGCATTGCTTGCTCGCCGCCTGCCTGTTCCTGCTCGCTTCGGCGGCGCACGGGCAGCAGCTCTCGTCGTCCTTCTACGCGGCGACATGCCCGACGCTG
GAGCTCATCGTGCGGACCACCATGCTCACGGCGCTCCTCGCCGAGCGTCGGATGGGCGCGTCCCTCGTCAGGCTCTTCTTCCACGACTGCTTTGTCCAA
GGCTGCGACGGCTCCATTCTT
CTGGACGACGTCGGCAGCTTCGTCGGCGAGAAGGGCGCCGGCCCCAACGTCAACTCTCTCCGCGGCTTCGACGTGATCGACCAGATCAAGGCCAACGTCGAGCTCATCTGCCCCGGCGTT
GTCTCCTGCGCCGACATTGTCGCCCTCGCCGCGCGAGACGGCACCTTCTTG
CTCGGAGGACCAAGCTGGGCGGTGCCGCTGGGCCGGCGCGACTCGACCACGGCGAGCCTGGCCCTGGCC
AACAGCGACCTGCCGTCGCCGGTCTCCGGCCTCGCCGCTCTCCTCGCAGCGTTCGGCAACAAGGGCCTGGGGCCCGGGGACCTGACGGCGCTCTCGGGCGCGCACACCATCGGCTTCTCG
CAGTGCCAGAACTTCCGCGCCCACATCTACAACGACACCGACATCGACCCGGCGTTCGCCAGCCTGCGCCAGCGCACCTGCCCCGCCGCGCCGGGCACCGGGGACAGCAGCCTGGCGCCG
CTCGACGTGCAGACGCAGCTCGTCTTCGACAACGCCTACTACCGCAACCTGCTGGCCAAGCGCGGCCTGCTGCGCTCCGACCAGGCGCTCTTCAACGGCGGCTCCCAGGACGCGCTGGTG
CGCCAGTACAGTGCCAACCCGGCCCTCTTCGCCTCAGACTTCGCCAACGCCATGATAAAGATGGGCAACATCAGCCCGCTCACCGGAACCGCGGGCCAGATCAGGGCAAACTGTAGGGTG
GTCAACAGCAGCTGA

Retrieve as FASTA