Entry information : ZmPrx125
Entry ID 6687
Creation 2009-04-10 (Christophe Dunand)
Last sequence changes 2009-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: ZmPrx125
Name ZmPrx125
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx125
start..stop
S start..stop
SiPrx125 534 0 17..320 23..328
HvPrx35 488 1e-175 6..320 9..326
OsPrx98 487 3e-175 17..320 26..330
SbPrx30 478 1e-171 8..319 19..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 162582360..162583157 798 N° 2 162582029..162582193 165  
complement(join(162582029..162582193,162582360..162583157))


exon

Literature and cross-references ZmPrx125
DNA ref. GenBank:   AC207350.4 (176726..175599)
mRNA ref. GenBank:   EU972037.1
Cluster/Prediction ref. UniGene:   Zm.134413
Protein sequence: ZmPrx125
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (299)
PWM (Da):   %s   33671.25 (31730.2)  
PI (pH):   %s   8.64 (8.57) Peptide Signal:   %s   cut: 22 range:22-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSAAALLLALAAAGSVCSAQQLRRNYYASVCPNVESIVRDAVAKKYRETFITVGATVHLFFHDCFVEGCDASVVVASTPNATAEKDHPINLSLAGDGFDTVIRAKAAVDAVPRCRNRVSCADILAMATRDAIALAGGPAYAVELGRLDGLSSTATSVNGKLAPPSFGLDQLTALFARNGLSQADMVALSAGHTVGFAHCGTFSGRVRAADPTLNRSLAEKLAAWCPDGVDPRVAVTMDVVTPRVFDNQYFRNLQSGMGLLASDQVLYTDPRSRPTVDALARSKVAFERAFVEGITKMGRIGVKTGAQGNIRRNCAVLN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 3') and 2 ESTs. Also found in AC217658.3 (5'end). Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTTTCAGCGGCGGCGCTCCTGCTGGCGCTGGCCGCGGCTGGCAGCGTCTGCTCGGCGCAGCAGCTCCGTCGCAACTACTACGCGAGCGTGTGCCCGAACGTGGAGTCCATCGTG
CGCGACGCGGTGGCGAAGAAGTACCGGGAGACGTTCATCACGGTGGGCGCGACGGTGCACCTCTTCTTCCACGACTGCTTCGTGGAGGGCTGCGACGCCTCCGTGGTGGTGGCGTCCACG
CCAAACGCCACCGCGGAGAAGGACCACCCCATCAACCTGTCCCTGGCGGGCGATGGCTTCGACACCGTGATCCGGGCCAAGGCCGCCGTGGACGCCGTGCCGCGGTGCCGGAACAGGGTG
TCCTGCGCCGACATCCTGGCCATGGCCACCCGGGACGCCATCGCGCTGGCCGGCGGGCCCGCGTACGCGGTGGAGCTGGGCCGCCTGGACGGGCTGTCCTCCACGGCGACCAGCGTGAAC
GGGAAGCTGGCGCCGCCGTCGTTTGGCCTGGACCAGCTCACCGCGCTGTTCGCGCGCAACGGGCTCTCGCAGGCCGACATGGTGGCGCTATCGGCGGGGCACACGGTGGGGTTCGCGCAC
TGCGGAACCTTCTCCGGGCGGGTCCGCGCGGCGGACCCGACGCTGAACCGGAGCCTGGCGGAGAAGCTGGCGGCGTGGTGCCCCGACGGCGTGGACCCGCGGGTGGCGGTGACCATGGAC
GTGGTCACGCCCAGGGTGTTCGACAACCAGTACTTCCGGAACCTGCAGAGCGGGATGGGCCTCCTGGCGTCGGACCAG
GTGCTGTTAGGGGTGGTAATGGATCGTGATCCAAATAGTTCT
TCACAAAATGTCAAAGCCCTAAATAAATTATAGTTCAAAAATGACTATAAATAGAGCCCGATCCTAACCCGCTTCGATCCTTAAATCTTATAGTGCAAAATTTATAGCCCATTGTCAGCC
CTAGGTGCTGTACACGGACCCCAGGTCTAGGCCCACCGTCGACGCGTTGGCCCGGAGTAAAGTGGCCTTTGAACGGGCCTTTGTGGAGGGGATCACGAAGATGGGCCGGATCGGGGTCAA
GACGGGTGCCCAAGGGAACATCCGACGTAACTGCGCAGTGCTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTTTCAGCGGCGGCGCTCCTGCTGGCGCTGGCCGCGGCTGGCAGCGTCTGCTCGGCGCAGCAGCTCCGTCGCAACTACTACGCGAGCGTGTGCCCGAACGTGGAGTCCATCGTG
CGCGACGCGGTGGCGAAGAAGTACCGGGAGACGTTCATCACGGTGGGCGCGACGGTGCACCTCTTCTTCCACGACTGCTTCGTGGAGGGCTGCGACGCCTCCGTGGTGGTGGCGTCCACG
CCAAACGCCACCGCGGAGAAGGACCACCCCATCAACCTGTCCCTGGCGGGCGATGGCTTCGACACCGTGATCCGGGCCAAGGCCGCCGTGGACGCCGTGCCGCGGTGCCGGAACAGGGTG
TCCTGCGCCGACATCCTGGCCATGGCCACCCGGGACGCCATCGCGCTGGCCGGCGGGCCCGCGTACGCGGTGGAGCTGGGCCGCCTGGACGGGCTGTCCTCCACGGCGACCAGCGTGAAC
GGGAAGCTGGCGCCGCCGTCGTTTGGCCTGGACCAGCTCACCGCGCTGTTCGCGCGCAACGGGCTCTCGCAGGCCGACATGGTGGCGCTATCGGCGGGGCACACGGTGGGGTTCGCGCAC
TGCGGAACCTTCTCCGGGCGGGTCCGCGCGGCGGACCCGACGCTGAACCGGAGCCTGGCGGAGAAGCTGGCGGCGTGGTGCCCCGACGGCGTGGACCCGCGGGTGGCGGTGACCATGGAC
GTGGTCACGCCCAGGGTGTTCGACAACCAGTACTTCCGGAACCTGCAGAGCGGGATGGGCCTCCTGGCGTCGGACCAG
GTGCTGTACACGGACCCCAGGTCTAGGCCCACCGTCGACGCG
TTGGCCCGGAGTAAAGTGGCCTTTGAACGGGCCTTTGTGGAGGGGATCACGAAGATGGGCCGGATCGGGGTCAAGACGGGTGCCCAAGGGAACATCCGACGTAACTGCGCAGTGCTCAAT
TGA

Retrieve as FASTA