Entry information : ZmPrx130
Entry ID 6692
Creation 2009-04-10 (Christophe Dunand)
Last sequence changes 2009-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-05-10 (Christophe Dunand)
Peroxidase information: ZmPrx130
Name ZmPrx130
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx130
start..stop
S start..stop
SbPrx106 561 0 30..334 36..341
SiPrx53 560 0 25..334 22..331
ZmPrx131 528 0 25..334 27..338
OsPrx137 523 0 14..334 8..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23525600..23525830 231 N° 2 23525311..23525496 186 N° 3 23525058..23525220 163 N° 4 23524562..23524986 425
complement(join(23524562..23524986,23525058..23525220,23525311..23525496,2352560 0..23525830))


exon

Literature and cross-references ZmPrx130
DNA ref. GenBank:   AC202404.3 (141350..140082)
EST ref. GenBank:   EC891004.2 [5' end]   DR967839.1 [3' end]
Cluster/Prediction ref. UniGene:   Zm.30743
Protein sequence: ZmPrx130
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (304)
PWM (Da):   %s   34442.98 (31694.5) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.22 (4.13) Peptide Signal:   %s   cut: 31 range:31-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGAGAAAAHIASSMVLSLLLVGVGVSRAQLQVGFYSDYCPDAEDTVTAAVQDAAGNDPTILPALLRLQFHDCFVKGCDASVLIRSASNDAEVDNGKNQGLRGQNVVDAAKAQLEDQCPGVVSCADIIALAARDAVAMTGGPSFDVPTGRRDGLTSNIRDADVLPDAGDSISVLRSRFAASGLDDRDLVLLTAAHTVGTTACFFVKDRLYSYPLPSGGRGPDPSIPASFLAELEDRCPPGNFNTRLALDRGSESDFDDSILRNIRSGLAVIASDAALANSNATRALVDAYLGPWAGSFEQDFAAAMVKMGTIGAITGDDAGEVRDVCSAFNSN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns) and 12 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCGGAGCTGGAGCGGCGGCGGCGCACATCGCATCATCGATGGTGTTGTCTCTGTTGCTTGTTGGAGTTGGCGTCTCCCGTGCCCAGCTCCAGGTGGGCTTCTACTCCGACTAC
TGCCCGGACGCCGAGGACACGGTCACCGCCGCCGTCCAGGACGCCGCCGGCAACGACCCCACCATCCTCCCCGCGCTGCTCCGCCTCCAGTTCCACGACTGCTTCGTCAAG
GTACGTACG
TGTGTCTGTGTGTGAGCACCATCCGGCCGATTAATACTTACTAGCTTTTACGTGTCTGTGTGTGTTCGCCGGCGCGCCGGCAATATATATGCAGGGGTGCGACGCGTCGGTGCTCATCAG
GAGCGCCAGCAACGACGCGGAGGTGGACAACGGCAAGAACCAGGGCCTGCGCGGCCAGAACGTGGTGGACGCCGCCAAGGCGCAGCTCGAGGACCAGTGCCCCGGCGTCGTCTCCTGCGC
CGACATCATCGCGCTCGCCGCGCGCGACGCCGTCGCCATG
GTAACATATAGTATTACCTAGCTAGGTAGATGCATGATGGTAGAGTACCTGCTGACGCGCTGGAAACTGGAATGCATGCC
ATGCCATCAGACGGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGGCGCGACGGGCTGACCTCTAACATCCGCGACGCCGACGTGCTGCCGGACGCCGGTGACTCTATCAGCGTGCTCCG
GTCACGCTTCGCCGCGAGCGGACTTGACGACCGCGACCTCGTCCTCCTCACAG
GTAGGTACTTCACCTTCACTACGTGCATATGGACATGGACGCGCATGACAGTGCAACGAGACCGGCC
GCAGCGGCGCACACGGTGGGCACGACGGCGTGCTTCTTCGTGAAGGACCGGCTCTACAGCTACCCGCTGCCGAGCGGCGGGAGGGGGCCGGACCCGTCGATCCCGGCGTCGTTCCTGGCG
GAGCTCGAGGACCGGTGCCCACCGGGCAACTTCAACACGCGGCTGGCGCTGGACCGCGGCAGCGAGAGCGACTTCGACGACTCCATCCTCCGGAACATCCGCTCTGGCCTCGCCGTCATC
GCCTCCGACGCCGCGCTGGCCAACAGCAACGCCACCCGCGCGCTCGTCGACGCGTACCTGGGCCCCTGGGCGGGCAGCTTCGAGCAGGACTTCGCGGCCGCCATGGTTAAGATGGGCACC
ATCGGCGCCATCACCGGGGACGACGCCGGCGAGGTCAGGGACGTCTGCTCCGCGTTCAACAGCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCGGAGCTGGAGCGGCGGCGGCGCACATCGCATCATCGATGGTGTTGTCTCTGTTGCTTGTTGGAGTTGGCGTCTCCCGTGCCCAGCTCCAGGTGGGCTTCTACTCCGACTAC
TGCCCGGACGCCGAGGACACGGTCACCGCCGCCGTCCAGGACGCCGCCGGCAACGACCCCACCATCCTCCCCGCGCTGCTCCGCCTCCAGTTCCACGACTGCTTCGTCAAG
GGGTGCGAC
GCGTCGGTGCTCATCAGGAGCGCCAGCAACGACGCGGAGGTGGACAACGGCAAGAACCAGGGCCTGCGCGGCCAGAACGTGGTGGACGCCGCCAAGGCGCAGCTCGAGGACCAGTGCCCC
GGCGTCGTCTCCTGCGCCGACATCATCGCGCTCGCCGCGCGCGACGCCGTCGCCATG
ACGGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGGCGCGACGGGCTGACCTCTAACATCCGC
GACGCCGACGTGCTGCCGGACGCCGGTGACTCTATCAGCGTGCTCCGGTCACGCTTCGCCGCGAGCGGACTTGACGACCGCGACCTCGTCCTCCTCACAG
CGGCGCACACGGTGGGCACG
ACGGCGTGCTTCTTCGTGAAGGACCGGCTCTACAGCTACCCGCTGCCGAGCGGCGGGAGGGGGCCGGACCCGTCGATCCCGGCGTCGTTCCTGGCGGAGCTCGAGGACCGGTGCCCACCG
GGCAACTTCAACACGCGGCTGGCGCTGGACCGCGGCAGCGAGAGCGACTTCGACGACTCCATCCTCCGGAACATCCGCTCTGGCCTCGCCGTCATCGCCTCCGACGCCGCGCTGGCCAAC
AGCAACGCCACCCGCGCGCTCGTCGACGCGTACCTGGGCCCCTGGGCGGGCAGCTTCGAGCAGGACTTCGCGGCCGCCATGGTTAAGATGGGCACCATCGGCGCCATCACCGGGGACGAC
GCCGGCGAGGTCAGGGACGTCTGCTCCGCGTTCAACAGCAATTGA

Retrieve as FASTA