Entry information : ZmPrx131
Entry ID 6693
Creation 2009-04-10 (Christophe Dunand)
Last sequence changes 2009-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx131
Name ZmPrx131
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx131
start..stop
S start..stop
ZmPrx130 552 0 17..338 16..334
SbPrx106 545 0 35..338 38..341
SiPrx53 536 0 25..338 20..331
OsPrx137 502 0 21..336 13..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 138772737..138772976 240 N° 2 138773113..138773298 186 N° 3 138773419..138773581 163 N° 4 138773652..138774079 428
join(138772737..138772976,138773113..138773298,138773419..138773581,138773652..1 38774079)


exon

Literature and cross-references ZmPrx131
DNA ref. GenBank:   AC207898.3 (88012..89354)
EST ref. GenBank:   DR964903.1 [5' end]   DV527248.1 [3' end]
Protein sequence: ZmPrx131
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   34904.67 Transmb domain:   %s   i7-29o
PI (pH):   %s   4.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAVACCWSYLVVVATVVLPLLLLGVIGVSRAQLLQVGFYSDSCPDAEATVAAAVQDAAANDPTILPALLRLQFHDCFVKGCDASVLIRSASNDAEVDNGRNQGLRGQEVVDAAKAQLEDQCPGVVSCADIIALAARDAVAMTGGPSFDVPTGRRDGLTSNLRDADVLPDAGDSISVLRSRFAASGLDDRDLVLLTAAHTVGTTACFFVKDRLYGYPLPGGGRGADPSIPAPYLAELKARCPPGNLNARLPLDRGSGSGFDDSILRNIRSGLAVIASDAALASSNATRALVDAYLQGPSARRFQRDFAAAMVKMGSIGVVTGEDAGEVRDVCSAFNAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 3, 3 introns) and 6 ESTs. Unigene contains EST from another Prx.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGTTGCTTGCTGTTGGAGCTACCTGGTAGTCGTAGCGACGGTGGTGTTACCGCTGTTGCTTCTCGGAGTTATTGGCGTCTCCCGTGCACAGCTCCTGCAGGTGGGCTTCTAC
TCCGACTCCTGCCCAGACGCCGAGGCCACGGTCGCCGCCGCCGTCCAGGACGCCGCCGCCAACGACCCCACCATCCTCCCCGCGCTGCTCCGCCTGCAGTTCCACGACTGCTTCGTCAAG
GTAAGACATATGCGCGCGCGCGGGCTGGCGCGCCGTCGTCGTTGTGTCCAGCAAGGCCGGGGCCGGGAGACTAATGCTAGCTTTTACTTGTCCGTGTGTGCTCGCTGGCGGCCGGCGCGG
CCGGCAATGTATGCAGGGGTGCGACGCGTCGGTGCTGATCAGGAGCGCCAGCAACGACGCGGAGGTGGACAACGGCAGGAACCAGGGCCTGCGCGGCCAGGAAGTGGTGGACGCCGCCAA
GGCGCAGCTCGAGGACCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCATCGCGCTCGCCGCGCGCGACGCCGTCGCCATG
GTATGGTAATACTAATAGCATGCATGCAATGCAATGCC
ATGATATGATGGTAGAGTACTGAGTAGTAGTAGTAGCCGTGCACGTCGTAGCAGCAGCTCACGCTCTGGAAATTAATTGCAGACGGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGGCG
CGACGGGCTGACCTCCAACCTCCGCGACGCCGACGTGCTGCCTGACGCCGGCGACTCCATCAGCGTGCTCCGCTCAAGGTTCGCCGCAAGCGGCCTCGACGACCGCGACCTCGTCCTCCT
CACAG
GTAGGTACTCTAACTCTACTCTACATGTCTACACCTGGCCCGCGATCTTCACAAACGACACCGGCCGCAGCGGCGCACACGGTGGGCACGACGGCGTGCTTCTTCGTGAAGGACC
GGCTGTACGGCTACCCGCTGCCGGGCGGCGGGAGGGGGGCGGACCCTTCGATCCCGGCGCCGTACCTGGCGGAGCTCAAGGCCCGGTGCCCGCCGGGCAACCTCAACGCGCGGCTGCCGC
TGGACCGCGGCAGCGGGAGCGGCTTCGACGACTCCATCCTCCGGAACATCCGCTCCGGCCTCGCCGTCATCGCCTCCGACGCCGCGCTGGCCAGCAGCAACGCCACCCGCGCGCTCGTCG
ACGCGTACCTGCAGGGCCCCTCGGCAAGAAGGTTCCAGCGCGACTTCGCGGCCGCCATGGTCAAGATGGGCAGCATCGGCGTCGTCACCGGGGAGGACGCCGGCGAGGTCAGGGACGTCT
GCTCCGCGTTCAATGCCAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGTTGCTTGCTGTTGGAGCTACCTGGTAGTCGTAGCGACGGTGGTGTTACCGCTGTTGCTTCTCGGAGTTATTGGCGTCTCCCGTGCACAGCTCCTGCAGGTGGGCTTCTAC
TCCGACTCCTGCCCAGACGCCGAGGCCACGGTCGCCGCCGCCGTCCAGGACGCCGCCGCCAACGACCCCACCATCCTCCCCGCGCTGCTCCGCCTGCAGTTCCACGACTGCTTCGTCAAG
GGGTGCGACGCGTCGGTGCTGATCAGGAGCGCCAGCAACGACGCGGAGGTGGACAACGGCAGGAACCAGGGCCTGCGCGGCCAGGAAGTGGTGGACGCCGCCAAGGCGCAGCTCGAGGAC
CAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCATCGCGCTCGCCGCGCGCGACGCCGTCGCCATG
ACGGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGGCGCGACGGGCTGACCTCC
AACCTCCGCGACGCCGACGTGCTGCCTGACGCCGGCGACTCCATCAGCGTGCTCCGCTCAAGGTTCGCCGCAAGCGGCCTCGACGACCGCGACCTCGTCCTCCTCACAG
CGGCGCACACG
GTGGGCACGACGGCGTGCTTCTTCGTGAAGGACCGGCTGTACGGCTACCCGCTGCCGGGCGGCGGGAGGGGGGCGGACCCTTCGATCCCGGCGCCGTACCTGGCGGAGCTCAAGGCCCGG
TGCCCGCCGGGCAACCTCAACGCGCGGCTGCCGCTGGACCGCGGCAGCGGGAGCGGCTTCGACGACTCCATCCTCCGGAACATCCGCTCCGGCCTCGCCGTCATCGCCTCCGACGCCGCG
CTGGCCAGCAGCAACGCCACCCGCGCGCTCGTCGACGCGTACCTGCAGGGCCCCTCGGCAAGAAGGTTCCAGCGCGACTTCGCGGCCGCCATGGTCAAGATGGGCAGCATCGGCGTCGTC
ACCGGGGAGGACGCCGGCGAGGTCAGGGACGTCTGCTCCGCGTTCAATGCCAGTTGA

Retrieve as FASTA