Entry information : ZmPrx135
Entry ID 6697
Creation 2009-04-11 (Christophe Dunand)
Last sequence changes 2009-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx135
Name ZmPrx135
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx135
start..stop
S start..stop
SbPrx124 523 0 4..330 3..323
SbPrx122 518 0 37..326 34..323
SiPrx101 517 0 4..330 3..317
SbPrx121 500 2e-180 42..328 39..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 102488572..102488847 276 N° 2 102488948..102489142 195 N° 3 102489266..102489428 163 N° 4 102489534..102489892 359
join(102488572..102488847,102488948..102489142,102489266..102489428,102489534..1 02489892)


exon

Literature and cross-references ZmPrx135
Literature Brent,M.R., Langton,L., Comstock,C.L. and Zimmerman,R. Exhaustive RT-PCR and sequencing of all novel TWINSCAN predictions in Zea mays.
DNA ref. GenBank:   AC186805.5 (136415..137735)
EST ref. GenBank:   EY254573.1 [Fragment]
Protein sequence: ZmPrx135
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (299)
PWM (Da):   %s   35482.66 (32323.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.77 (4.67) Peptide Signal:   %s   cut: 35 range:32-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEDASSRVSSLLGLLLAAHCALLLLLRLAGAAHGHGYAPAPGGGVALSSAFYDESCPSAYDVVRRVIQDARVSDPRIPASLIRLHFHDCFVNGCDGSLLLDDDLPAIQSEKHVPANDKSARGFEVVDGIKSALEEACPGIVSCADILALAAEISVELAGGPRWRVLLGRRDGTTTNIEGANNLPSPFDPLDKLQEKFRNFNLDDTDLVALQGAHTFGKVQCQFTQENCTAGQPEETLENLDQVTPNVFDNKYYGNLLHGAAQLPSDQVMLSADPVAEMTTAPIVHRFAGNQEDFFRNFAASMVKMGNISPLTRNDGEIRKFCRRINSEGY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 3 introns) and 1 EST. Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGACGCTTCCTCTCGCGTCTCGTCTCTCCTCGGGTTGCTGTTAGCCGCCCACTGCGCACTCTTGCTCTTGCTCCGTTTGGCTGGAGCTGCTCACGGCCACGGTTACGCTCCCGCT
CCTGGCGGCGGCGTGGCGCTGAGCTCCGCGTTCTACGACGAGTCGTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGATGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGT
CTCATCCGCCTGCACTTCCACGACTGCTTCGTCAAC
GTGAGCACCAGTGCTGTGCTTCTGCGCGCCCGTGGGCGTGGCTTATCACTTATCAGTGTCGTTGTATCATCTGACAAGGATGAA
CGGCCAAATGTTTCAGGGTTGCGATGGCTCGCTGCTGCTGGACGACGATCTCCCGGCGATCCAGTCGGAGAAACACGTGCCCGCCAACGACAAATCAGCGCGTGGCTTCGAGGTGGTCGA
TGGCATCAAGAGCGCGCTGGAGGAAGCGTGCCCTGGCATCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGTCGAACTC
GTAAGAATTGAACCCCATACCTTCTCTGG
CTTCTCCCAGTCCCAGCTAGCTAGTGAACAGCAGCTTAATTACATCTCAACTGATCAGAACTGACCAAATCATGGACTGCGTGATTGCTTGCAGGCTGGAGGGCCACGATGGAGGGTGCT
GCTCGGCCGGCGAGACGGCACGACGACTAACATCGAGGGCGCCAACAACCTACCCAGCCCATTCGACCCGCTCGACAAGCTCCAAGAGAAGTTCAGAAACTTTAACCTGGACGACACCGA
CCTCGTCGCCCTCCAAG
GTAACGACCGTCGACTTTGTTATCAATAATAATCTCTCTTTGTTACATACTAACTATATGGGTTACATACTGACGATTTCAACAAATTTCCCTATTTCAATTC
AGGAGCACACACTTTTGGTAAAGTACAGTGTCAATTCACACAAGAGAACTGCACAGCTGGGCAGCCAGAGGAAACACTAGAAAACCTAGACCAGGTCACCCCCAACGTGTTTGACAACAA
GTATTACGGTAACCTCCTGCATGGCGCCGCACAGCTACCCTCCGACCAGGTCATGCTGTCGGCGGACCCTGTCGCGGAGATGACGACCGCTCCCATTGTTCATCGGTTTGCAGGCAACCA
AGAAGACTTCTTTAGAAACTTTGCCGCATCTATGGTTAAGATGGGCAACATAAGCCCGCTAACTAGGAACGATGGAGAGATACGGAAATTTTGCCGAAGGATTAATAGCGAAGGCTATTG
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGACGCTTCCTCTCGCGTCTCGTCTCTCCTCGGGTTGCTGTTAGCCGCCCACTGCGCACTCTTGCTCTTGCTCCGTTTGGCTGGAGCTGCTCACGGCCACGGTTACGCTCCCGCT
CCTGGCGGCGGCGTGGCGCTGAGCTCCGCGTTCTACGACGAGTCGTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGATGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGT
CTCATCCGCCTGCACTTCCACGACTGCTTCGTCAAC
GGTTGCGATGGCTCGCTGCTGCTGGACGACGATCTCCCGGCGATCCAGTCGGAGAAACACGTGCCCGCCAACGACAAATCAGCG
CGTGGCTTCGAGGTGGTCGATGGCATCAAGAGCGCGCTGGAGGAAGCGTGCCCTGGCATCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGTCGAACTC
GCTGGAGGG
CCACGATGGAGGGTGCTGCTCGGCCGGCGAGACGGCACGACGACTAACATCGAGGGCGCCAACAACCTACCCAGCCCATTCGACCCGCTCGACAAGCTCCAAGAGAAGTTCAGAAACTTT
AACCTGGACGACACCGACCTCGTCGCCCTCCAAG
GAGCACACACTTTTGGTAAAGTACAGTGTCAATTCACACAAGAGAACTGCACAGCTGGGCAGCCAGAGGAAACACTAGAAAACCTA
GACCAGGTCACCCCCAACGTGTTTGACAACAAGTATTACGGTAACCTCCTGCATGGCGCCGCACAGCTACCCTCCGACCAGGTCATGCTGTCGGCGGACCCTGTCGCGGAGATGACGACC
GCTCCCATTGTTCATCGGTTTGCAGGCAACCAAGAAGACTTCTTTAGAAACTTTGCCGCATCTATGGTTAAGATGGGCAACATAAGCCCGCTAACTAGGAACGATGGAGAGATACGGAAA
TTTTGCCGAAGGATTAATAGCGAAGGCTATTGA

Retrieve as FASTA