Entry information : AruPrx05 (HRPE5 / HRP_E5)
Entry ID 67
Creation 2006-09-05 (Christophe Dunand)
Last sequence changes 2014-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-05 (Christophe Dunand)
Peroxidase information: AruPrx05 (HRPE5 / HRP_E5)
Name (synonym) AruPrx05 (HRPE5 / HRP_E5)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx05
start..stop
S start..stop
AruPrx23 608 0 1..333 1..335
AlyPrx22 589 0 1..333 1..335
AhalPrx38 588 0 1..333 1..335
AlyPrx23 582 0 1..333 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35..256 222 N° 2 430..621 192 N° 3 716..884 169 N° 4 1272..1732 461
join(35..256,430..621,716..884,1272..1732)


exon

Literature and cross-references AruPrx05 (HRPE5 / HRP_E5)
Literature REFERENCE 1 Morita,Y. et al Primary and crystal structures of horseradish peroxidase isozyme E5.
REFERENCE 2 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome. BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW57   P59121
DNA ref. GenBank:   HE963808.1
Protein sequence: AruPrx05 (HRPE5 / HRP_E5)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (306)
PWM (Da):   %s   36269.44 (33545.1)  
PI (pH):   %s   8.56 (8.76) Peptide Signal:   %s   cut: 28 range:28-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVSPFFSCSAMGALILGCLLLQASNAQLRPDFYSRTCPSVFNIIKNVIVDELQTDPRIAASILRLHFHDCFVRGCDASILLDTSKSFRTEKDAAPNVNSARGFNVIDRMKTALERACPRTVSCADILTIASQISVLLSGGPSWAVPLGRRDSVEAFFDLANTALPSPFFTLAQLKKAFADVGLNRPSDLVALSGGHTFGRARCLFVTARLYNFNGTNRPDPTLNPSYLADLRRLCPRNGNGTVLVNFDVMTPNTFDNQFYTNLRNGKGLIQSDQELFSTPGADTIPLVNLYSSNTLSFFGAFADAMIRMGNLRPLTGTQGEIRQNCRVVNSR

Retrieve as FASTA  
Remarks Complete seqyuence from genomic (3 introns) and mature sequence protein.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGTTTCTCCTTTCTTTTCTTGCAGTGCTATGGGAGCCCTAATATTGGGTTGCCTTCTGCTTCAAGCATCTAATGCTCAGTTGAGGCCTGACTTCTACTCTAGGACTTGCCCATCT
GTTTTCAATATTATTAAGAATGTCATCGTCGATGAACTGCAGACTGATCCTCGCATTGCCGCTAGTATCCTTCGCCTTCACTTTCATGACTGCTTTGTTCGT
GTAAGTACTTAACTTATG
TTTTTATTATTAATAAAAAAAAACCATGACGAATTCATATTGGACGAAACTACTTTTTATACCATTTAATTTACTTATAGGTTAGAGGCCAAAAGGCATATTTGAATCAACAAGTACAAT
CGTCATATAACGTATAATATCTATGGTTTTTGTAGGGTTGTGATGCATCGATCCTGCTTGACACTTCCAAATCGTTCCGAACCGAAAAAGATGCTGCTCCAAACGTAAATTCGGCTCGAG
GGTTCAATGTCATAGATAGAATGAAAACAGCACTTGAGAGAGCTTGTCCTAGAACAGTGTCTTGCGCAGATATTCTCACCATCGCCTCTCAAATATCAGTGCTTTTG
GTATGTACATATA
CCTATATATGACTTATAATATCGGGTGAAATTAATAAAAATATGTTATGAAATTTTGACGTCAATGCTTTATATGTTATAGTCGGGAGGTCCATCTTGGGCAGTTCCGTTGGGGAGGAGA
GACAGCGTAGAAGCTTTCTTTGACCTAGCTAATACAGCTCTTCCCTCTCCATTTTTCACTCTTGCTCAACTTAAAAAAGCTTTTGCTGACGTTGGTTTAAACCGCCCCTCAGATCTAGTC
GCTCTTTCTG
GTAAACTATATATATTCATGTTGTTTATAATATAAAGTGTTTTATATAAAATGATAGCTAACCACACCCACTCCGCGATCGATGAGGTCTAGAATTTACACACTAATTTA
TAAGTTATAGAATTACAAAATTTTATTATTTTGTATTTATTAATATGATTTGCTTTTGGCTTTGAAATACATGACCAAGTATAAAATGAAAAACAAAATGGATAATATAATCAAATAATA
ATACTATTTCAGACAAAACATCATCTAGCACGTGATTTTGAATTATAAGATAAGATGGTAAAACGACAAAACATGACTATTATTTTTTTACCTTTTTTTTTTTTAATTGTCAAACTGACA
CATACAATGTATCTAAACCTTATTGTCAAAATGGTAGGTGGTCACACATTTGGAAGAGCACGATGCCTATTTGTGACAGCTCGTCTCTACAACTTCAACGGTACAAACAGACCAGACCCA
ACTCTGAACCCATCTTACCTCGCCGACCTCCGTCGATTGTGCCCTCGAAACGGAAACGGCACCGTTCTGGTCAACTTCGATGTCATGACTCCGAATACTTTCGATAATCAATTCTACACT
AATCTTAGAAATGGGAAAGGTCTGATTCAGAGTGACCAAGAGCTCTTCTCGACTCCAGGAGCCGACACGATCCCACTAGTAAACCTATACAGCAGCAACACGTTATCGTTCTTCGGAGCA
TTCGCTGATGCAATGATTAGGATGGGAAATCTTAGACCTTTGACTGGAACTCAAGGCGAGATAAGACAGAATTGTAGGGTTGTGAATTCGCGAATTAGGGGTATGGAGAACGATGATGGA
GTTGTGAGTTCTATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGTTTCTCCTTTCTTTTCTTGCAGTGCTATGGGAGCCCTAATATTGGGTTGCCTTCTGCTTCAAGCATCTAATGCTCAGTTGAGGCCTGACTTCTACTCTAGGACTTGCCCATCT
GTTTTCAATATTATTAAGAATGTCATCGTCGATGAACTGCAGACTGATCCTCGCATTGCCGCTAGTATCCTTCGCCTTCACTTTCATGACTGCTTTGTTCGT
GGTTGTGATGCATCGATC
CTGCTTGACACTTCCAAATCGTTCCGAACCGAAAAAGATGCTGCTCCAAACGTAAATTCGGCTCGAGGGTTCAATGTCATAGATAGAATGAAAACAGCACTTGAGAGAGCTTGTCCTAGA
ACAGTGTCTTGCGCAGATATTCTCACCATCGCCTCTCAAATATCAGTGCTTTTG
TCGGGAGGTCCATCTTGGGCAGTTCCGTTGGGGAGGAGAGACAGCGTAGAAGCTTTCTTTGACCTA
GCTAATACAGCTCTTCCCTCTCCATTTTTCACTCTTGCTCAACTTAAAAAAGCTTTTGCTGACGTTGGTTTAAACCGCCCCTCAGATCTAGTCGCTCTTTCTG
GTGGTCACACATTTGGA
AGAGCACGATGCCTATTTGTGACAGCTCGTCTCTACAACTTCAACGGTACAAACAGACCAGACCCAACTCTGAACCCATCTTACCTCGCCGACCTCCGTCGATTGTGCCCTCGAAACGGA
AACGGCACCGTTCTGGTCAACTTCGATGTCATGACTCCGAATACTTTCGATAATCAATTCTACACTAATCTTAGAAATGGGAAAGGTCTGATTCAGAGTGACCAAGAGCTCTTCTCGACT
CCAGGAGCCGACACGATCCCACTAGTAAACCTATACAGCAGCAACACGTTATCGTTCTTCGGAGCATTCGCTGATGCAATGATTAGGATGGGAAATCTTAGACCTTTGACTGGAACTCAA
GGCGAGATAAGACAGAATTGTAGGGTTGTGAATTCGCGAATTAGGGGTATGGAGAACGATGATGGAGTTGTGAGTTCTATGTGA

Retrieve as FASTA