Entry information : ZmPrx140
Entry ID 6702
Creation 2009-04-11 (Christophe Dunand)
Last sequence changes 2009-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx140
Name ZmPrx140
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx140
start..stop
S start..stop
SbPrx94 612 0 1..352 4..347
SiPrx50 590 0 1..352 1..347
OsPrx56 535 0 1..352 1..328
BdiPrx132 528 0 1..352 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 143480882..143481157 276 N° 2 143481339..143481530 192 N° 3 143481659..143481827 169 N° 4 143482077..143482498 422
join(143480882..143481157,143481339..143481530,143481659..143481827,143482077..1 43482498)


exon

Literature and cross-references ZmPrx140
DNA ref. GenBank:   AC190752.2 (89722..91338)
Protein sequence: ZmPrx140
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (331)
PWM (Da):   %s   37739.17 (35448.9)  
PI (pH):   %s   8.72 (8.56) Peptide Signal:   %s   cut: 22 range:22-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSRLLFGLVVLPLSLQYSSSALSNPPEEFGGGGLQQPSPPPTSSGLRVGFYQYTCPNAEAIVRDEMAKIISRVPSLAGPLLRMHFHDCFVNGCDGSVLLNSTVPGLPSEKEAIPNLTLRGFGTVDRVKAKLEQACPGVVSCADILALVARDVVVLTKGPHWDVPTGRRDGRRSVKQDALDNLPAPFFDAGRNLYQFFIPKGLDAKDQVVLLGAHTLGTSHCSSFADRLYNFSGTTAADPSLDRRYLPRLKSKCGSPGDTTTLVEMDPGSFRTFDASYYRRVARGRSLFASDQTLMNDPAARAYVQRQAGAGAGAYPAEFFADFAKSMVKMGAVQVLTGAQGEVRRHCAAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTCCAGGCTTCTCTTCGGACTCGTCGTCCTTCCTCTCTCCCTACAATATTCCTCATCGGCGCTATCCAATCCACCAGAAGAGTTCGGCGGCGGCGGGCTGCAACAACCCTCGCCG
CCGCCGACGTCGTCGGGGCTGCGGGTCGGATTCTACCAGTACACGTGCCCGAACGCGGAGGCCATCGTTCGCGACGAGATGGCCAAGATCATCTCCCGAGTCCCGAGCCTCGCCGGGCCC
CTGCTCCGGATGCACTTCCACGACTGCTTTGTGAAT
GTAAGCGTACGTGCATGGTCATGCTCATGCATCGCATGCATTTTAGTACGTCTGTTCCTGACGACGGACGAACTGCTAGCAGCT
AGTTGCTTTATTCTCAGCCGAGTTCATGCATGCATGTGTTTCCGAAGGATTGTTCTGAAACGACGACGTACTGAAGAATTATGTGTGATATATGCAGGGATGCGACGGTTCCGTTCTTCT
GAACAGCACCGTGCCAGGGCTGCCATCCGAGAAGGAGGCGATACCGAACCTCACCTTGCGAGGCTTCGGCACCGTCGACCGCGTGAAGGCGAAGCTGGAGCAGGCCTGCCCTGGAGTGGT
GTCGTGTGCTGACATCTTGGCTCTGGTAGCCAGGGACGTCGTTGTGCTG
GTAAGACGAAGCTCGTAGGACGATAGTCTTGATCCTTCAACTAACTTAATTAGGATGATTATTGGCGTTGG
CCTAATTATTGTTTCCTCTGCTACTGTGTACGTGCAACGTACGTACGAGTACGACAGACCAAAGGGCCTCACTGGGATGTTCCAACAGGGCGGAGAGACGGGAGGAGATCGGTGAAGCAA
GATGCTCTGGACAACCTCCCCGCGCCCTTCTTCGACGCTGGTCGGAACCTGTACCAGTTCTTCATCCCCAAGGGCCTCGATGCCAAGGACCAGGTTGTTCTGCTAG
GTAAAAATTCCAGG
ATATATATGCCTTGATTGCATTGGTACTGCTGGATCTTTCTCGCCTGGTCGTTCTTGTAGACCATGCAATGCAAATGCAATGATTCTCTTTTAGAAACCTGTGTCATCAGCAACATTCCC
CGATAAAGGCGACCATCTGTAGTTTAGTAACTAAGAAGCAACTTGTTCGTGTGAAAGAAGGCAGCATAATTAACAAGTCAACTAAACTAAACTAATACTAACGTGCATGGTACAGGAGCG
CACACTCTGGGGACCTCCCACTGCTCGTCGTTCGCGGACCGGCTGTACAACTTCAGCGGCACGACGGCGGCGGACCCGTCCCTGGACAGGCGCTACCTCCCGCGGCTGAAGAGCAAGTGC
GGCAGCCCCGGCGACACGACGACGCTGGTGGAGATGGACCCGGGCAGCTTCCGGACGTTCGACGCGAGCTACTACCGGCGCGTCGCCAGGGGCCGGTCGCTGTTCGCCTCCGACCAGACG
CTGATGAACGACCCCGCGGCCCGGGCCTACGTCCAGCGGCAGGCCGGCGCCGGCGCCGGCGCCTACCCCGCCGAGTTCTTCGCCGACTTCGCCAAGTCCATGGTGAAGATGGGCGCCGTG
CAGGTGCTCACCGGCGCGCAGGGGGAGGTCCGGAGGCACTGCGCCGCCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTCCAGGCTTCTCTTCGGACTCGTCGTCCTTCCTCTCTCCCTACAATATTCCTCATCGGCGCTATCCAATCCACCAGAAGAGTTCGGCGGCGGCGGGCTGCAACAACCCTCGCCG
CCGCCGACGTCGTCGGGGCTGCGGGTCGGATTCTACCAGTACACGTGCCCGAACGCGGAGGCCATCGTTCGCGACGAGATGGCCAAGATCATCTCCCGAGTCCCGAGCCTCGCCGGGCCC
CTGCTCCGGATGCACTTCCACGACTGCTTTGTGAAT
GGATGCGACGGTTCCGTTCTTCTGAACAGCACCGTGCCAGGGCTGCCATCCGAGAAGGAGGCGATACCGAACCTCACCTTGCGA
GGCTTCGGCACCGTCGACCGCGTGAAGGCGAAGCTGGAGCAGGCCTGCCCTGGAGTGGTGTCGTGTGCTGACATCTTGGCTCTGGTAGCCAGGGACGTCGTTGTGCTG
ACCAAAGGGCCT
CACTGGGATGTTCCAACAGGGCGGAGAGACGGGAGGAGATCGGTGAAGCAAGATGCTCTGGACAACCTCCCCGCGCCCTTCTTCGACGCTGGTCGGAACCTGTACCAGTTCTTCATCCCC
AAGGGCCTCGATGCCAAGGACCAGGTTGTTCTGCTAG
GAGCGCACACTCTGGGGACCTCCCACTGCTCGTCGTTCGCGGACCGGCTGTACAACTTCAGCGGCACGACGGCGGCGGACCCG
TCCCTGGACAGGCGCTACCTCCCGCGGCTGAAGAGCAAGTGCGGCAGCCCCGGCGACACGACGACGCTGGTGGAGATGGACCCGGGCAGCTTCCGGACGTTCGACGCGAGCTACTACCGG
CGCGTCGCCAGGGGCCGGTCGCTGTTCGCCTCCGACCAGACGCTGATGAACGACCCCGCGGCCCGGGCCTACGTCCAGCGGCAGGCCGGCGCCGGCGCCGGCGCCTACCCCGCCGAGTTC
TTCGCCGACTTCGCCAAGTCCATGGTGAAGATGGGCGCCGTGCAGGTGCTCACCGGCGCGCAGGGGGAGGTCCGGAGGCACTGCGCCGCCGTCAACTAG

Retrieve as FASTA