Entry information : ZmAPx02_B73 (APx2 / GRMZM2G140667 [6a])
Entry ID 6705
Creation 2009-04-12 (Christophe Dunand)
Last sequence changes 2011-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-07-07 (Christophe Dunand)
Peroxidase information: ZmAPx02_B73 (APx2 / GRMZM2G140667 [6a])
Name (synonym) ZmAPx02_B73 (APx2 / GRMZM2G140667 [6a])
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx02_B73
start..stop
S start..stop
SbAPx02 509 0 1..250 1..250
ZmAPx02_H99 509 0 1..250 1..250
SiAPx02 498 0 1..250 1..250
HvAPx03 477 1e-173 3..250 4..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 218591813..218591931 119 N° 2 218591540..218591714 175 N° 3 218591381..218591446 66 N° 4 218590574..218590622 49
N° 5 218590137..218590222 86 N° 6 218589983..218590062 80 N° 7 218589813..218589915 103 N° 8 218589675..218589733 59
N° 9 218589569..218589584 16  
complement(join(218589569..218589584,218589675..218589733,218589813..218589915,2 18589983..218590062,218590137..218590222,218590574..218590622,218591381..2185914 46,218591540..218591714,218591813..218591931))


exon

Literature and cross-references ZmAPx02_B73 (APx2 / GRMZM2G140667 [6a])
Protein ref. UniProtKB:   B4FWL1   B4G031   B6TVL8 [Other strain]
mRNA ref. GenBank:   BT041499
Cluster/Prediction ref. UniGene:   Zm.76
Protein sequence: ZmAPx02_B73 (APx2 / GRMZM2G140667 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27139.74  
PI (pH):   %s   5.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKAYPTVNEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTMKNPAEQAHGANAGLEIAIRLLEPIKEQFPILSYADFYLAGVVAVEVTGGPDVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPLVDKYADEDAFFADYAEAHLKLSELGFAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 8 introns), 6 mRNA sequences and 145 EST sequences. Incorrect prediction from Phytozome (extra aa around the splicing sites). Strain="B73" and "hybrid 35A19".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCCTACCCCACGGTGAACGAGGACTACCTCAAGGCGGTCGACAAGGCCAAGCGTAAGCTCCGCGGCCTCATCGCCGAGAAGAATTGCGCCCCGCTCATGCTCCGCCTCGCG
TAAGGCTGCTCCCCCTTCTTATTCTTCGCCCGATCCCGATCCTATTCGGAAATCCAGAAACTGCTACCACTCCAACTCCTTCCTTGTCCCCTCGCAGATGGCACTCCGCGGGCACCTTCG
ATGTGGCCACCAAAACCGGGGGCCCCTTCGGCACCATGAAGAACCCCGCCGAGCAGGCGCACGGAGCCAACGCCGGACTGGAAATTGCCATCAGGCTGCTAGAGCCCATCAAGGAGCAGT
TCCCCATCCTATCCTACGCTGACTTCTACCAG
GTTACCTGCCTATTGCAACTTCGATTACCCATCCTTTCGTATGATTAGATTAGATAGACTAACACGAATTTATTTACGGTTACGGTGT
TGCAGCTTGCTGGAGTCGTGGCAGTCGAGGTAACCGGCGGACCTGATGTCCCCTTCCACCCTGGGAGGCAGGTGAGGCTGGTCCCTTTTCTAATAAACCTTTTTAGTTTTATATTGGAAA
ATTTGGATCCATACCATTAAAAGATCACCACTTTGGATCCATATCATTACTATCTCACTTACATGTGGGTCCACATGAGTCAATGACATGTGGGGTCCATGGTATATATCTAAAGTTTGG
ATCTTTTAATGGTATAGATCCAATTGTTCCTTTTATATTAGATAAGAAGATGCAGTGTTTGTCGGAGGCTCATAAGTGTGGTTTGGAGAATTGATAACCTGTTCTTCGGCAAATACAGAT
TGCTTCGAACCTGTGGCCTCTCAGTGAGACACGCATCCTTGGTCTTATGTTGGATATGTAAAAACTAATCATCAAGCCCTAGACTAATCCAACCCAAACCCAATATTTTGGTAGGGTTTA
TTTAAGCAAAACTAACCCTATTGTCATCAGCCTGTCTACCATTGTACCTGGGAAAGTGGTCTTGATGCTGACACATGTTTCCACTGTTTGATGGCCAGCTTATGGTTAAATAGAGGATAA
GCTTGTATAATTAGTAACTAGCTATGTACTGTGTGATGTATTATTTTACATGGGGCATAAAATACTTGTAGTAGTTTATTGCCTAATACTCTTGCCTGGGAGCTGGAGACGTTATAGTGA
CCGCGAGTGGGAATATGTTATTAGGCATCATTGCTTTAGACTGTTGTTTCTTTACTGTATTTGTCTTGTAGCTACAGATGTTGATGAAAGCATTGTCTTTATTGTGTAGGACAAGCCTGA
GCCTCCACCGGAAGGCCGCCTTCCTGATGCCACCCAAG
GTACAATTGTAAAATTCCTGTGAAGCTTCTGACTCGATGTTCTGTGAGACATGAGAAAAATGTTTTGTAATAATATGTTGTT
GTGTTTACATCTCGTCATTTAGCATTTAGCATCTCAGTGGTAGCAGTACCTAAGTCTTGTTCTGCAGATTTGCATGCTTCTGGGTGTGGGATCTTTCTTTGACTATAAAAGAAATCTTCT
CAACAGTTAATGGCTTGATGCATAATAGTTCATTGGTCTGTGTTCTTGGATTGCCTTCTTTGTGATGTGAAGGATAAAGTTAGAGTATTTCTCAATGGTAGGAATGGGATAGGTGGACTT
ACTGGTTGGGTCTCTCTTGTATGAATCAGGTTCTGATCACCTCAGGCAGGTTTTCTCCACACAGATGGGTTTGAGCGACCAGGACATTGTTGCGCTTTCTGGTGGTCACACCCTGGTTGG
TGGATTTTTTTTATTTTTTTGTCAACTTTTGAAAGCTGGTGCTTATGCACAGTTGTCTCTTTCTTGTAGGGAAGATGCCACAAGGACAGGTCTGGATTTGAGGGAGCCTGGACGTCCAAC
CCTTTGATCTTTGACAACTCTTACTTCAA
GTACGTGATCTTCCTTGATACTGTGCTGTACTTTGTTGGTTAAACTGAAGACAACACTGACTGACAGGGAGCTTCTGAGCGGAGAGAAGGA
AGGCCTTCTGCAGCTACCAAGTGACAAAGCCCTCCTCTCTGATCCATCCTTCCGCCCACTTGTTGACAAATACGCAGCG
GTATAATATATATTTGATCCTTATCATATTTGTTGAGATGG
GTTTATGCTATTGTTACCTGGGATGGGTTGATTTGTAGGACGAGGACGCTTTCTTTGCTGACTACGCCGAGGCCCACCTGAAGCTTTCAGAATTGGGGTAAGCGGTGCTGATAGATCTAT
CATCTATTTCTATGTATTATGATTCTATGTATTATGACTGAATGATTGTATCTCTTGCACTATGCAGATTTGCTGAGGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCCTACCCCACGGTGAACGAGGACTACCTCAAGGCGGTCGACAAGGCCAAGCGTAAGCTCCGCGGCCTCATCGCCGAGAAGAATTGCGCCCCGCTCATGCTCCGCCTCGCA
TGGCACTCCGCGGGCACCTTCGATGTGGCCACCAAAACCGGGGGCCCCTTCGGCACCATGAAGAACCCCGCCGAGCAGGCGCACGGAGCCAACGCCGGACTGGAAATTGCCATCAGGCTG
CTAGAGCCCATCAAGGAGCAGTTCCCCATCCTATCCTACGCTGACTTCTACCAG
CTTGCTGGAGTCGTGGCAGTCGAGGTAACCGGCGGACCTGATGTCCCCTTCCACCCTGGGAGGCAG
GACAAGCCTGAGCCTCCACCGGAAGGCCGCCTTCCTGATGCCACCCAAGGTTCTGATCACCTCAGGCAGGTTTTCTCCACACAGATGGGTTTGAGCGACCAGGACATTGTTGCGCTTTCT
GGTGGTCACACCCTG
GGAAGATGCCACAAGGACAGGTCTGGATTTGAGGGAGCCTGGACGTCCAACCCTTTGATCTTTGACAACTCTTACTTCAAGGAGCTTCTGAGCGGAGAGAAGGAA
GGCCTTCTGCAGCTACCAAGTGACAAAGCCCTCCTCTCTGATCCATCCTTCCGCCCACTTGTTGACAAATACGCAGCG
GACGAGGACGCTTTCTTTGCTGACTACGCCGAGGCCCACCTG
AAGCTTTCAGAATTGGG
ATTTGCTGAGGCGTAA

Retrieve as FASTA