Entry information : PplKat01
Entry ID 6719
Creation 2009-04-29 (Christophe Dunand)
Last sequence changes 2009-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Catherine Mathe (Scipio))
Peroxidase information: PplKat01
Name PplKat01
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplKat01
start..stop
S start..stop
PcarKat01 800 0 1..506 1..506
PcKat01 789 0 1..506 1..506
LbiKat01 787 0 1..506 1..516
SlutKat01 771 0 1..506 1..516
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140717..140840 124 N° 2 140893..140943 51 N° 3 141005..141184 180 N° 4 141240..141397 158
N° 5 141454..141747 294 N° 6 141801..142045 245 N° 7 142102..142325 224 N° 8 142382..142507 126
N° 9 142567..142694 128  
join(140717..140840,140893..140943,141005..141184,141240..141397,141454..141747, 141801..142045,142102..142325,142382..142507,142567..142694)


exon

Literature and cross-references PplKat01
Literature Martinez,D. et al., Genome, transcriptome, and secretome analysis of wood decay fungus Postia placenta supports unique mechanisms of lignocellulose conversion. Proc. Natl. Acad. Sci. U.S.A. 106 (6), 1954-1959 (2009)
DNA ref. JGI genome:   scaffold_125 (140717..142694)
mRNA ref. JGI transcript:   123169
Protein sequence: PplKat01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   509
PWM (Da):   %s   56982.81  
PI (pH):   %s   7.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSKQVFSTQDNAVYTTSVGAPVAQPYAAQRIGSVGPLLLQDFHHIDLLAHFDRERIPERVVHAKGAGAHGYFEVTHDITDLSCASIFSKVGNKARATVRFSTVGGESGSPDTARDPRGFAIKIKTDEGNLDWVFNNTPVFFIRDPAKFPHFIHTQKRDPQTHLKDADMFDYLSLNPESIHQVMILFSDRGHPDGYHNMHAYSGHTFKFVNKDGKFHYVQIHFLKDGGAKSLTEPEAGRLAGENPDYGIQSLFEAIEEGNYPSWTGYVQTMTAEQAEKFRYNVLDLTKVWPHKEFPLRPFGKLVLNENPQNYFAEIEQAAFSPSHTVPGIEPSADPVLQSRLFSYPDTHRHRLGTNYNQLPVNAPIAPVANFQRDGAMTFVSQGARPNYQSSLVPLKYKPKAYEEVKHETWLGHANADLSFVTLDFEQPRALYQKVFSDTDRDHLVHNIKVHLRNAKSIEVKNRTISVWAAVDQSLGDRIAAAIGVAPVPALKVAPASEAIRFKTFA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 20 ESTs. Also found in scaffold_49 (226476..224497) with minor mismatches.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTAAGCAGGTCTTCAGCACCCAGGACAACGCTGTCTACACCACCTCCGTTGGTGCACCCGTAGCTCAGCCGTACGCCGCCCAGCGTATCGGTAGCGTCGGTCCTCTACTCCTC
CAGG
GTGCGTTGTCTATCTTCGCGCATTAAGCATGGACTAACAGGAGATCTTGCAGACTTCCACCACATTGACCTCCTTGCGCACTTTGACCGCGAGCGTATCCCTGGTATGCGCAACGC
CCCTGTCTAATGCAGTGCGGGGCAATGTGTTCACTGTTCTCTCCTTAGAGCGTGTCGTACATGCGAAGGGTGCCGGTGCTCACGGCTACTTCGAGGTGACCCACGACATCACGGACCTGT
CCTGCGCATCGATCTTCTCCAAAGTCGGTAACAAGGCGAGGGCAACTGTCCGGTTCTCGACTGTTGGTGGTGAATCTGGGTCGCCAGACACTGCCCGCGACCCAAGAG
GTACAGCTCAAT
CCAATTGTGTGTGGAGCGTGTCGCTCATGCTATCGCCGCACAGGATTCGCGATTAAGATCAAGACTGACGAGGGGAACCTCGACTGGGTGTTCAACAACACGCCCGTCTTCTTCATCAGG
GATCCCGCAAAATTCCCCCACTTCATCCACACTCAGAAGCGCGACCCACAGACGCACCTCAAGGATGCGGACATGTTTTGG
GTGCGCTTGATTTCTGTAAGATGTTGTAAATCCAGGCTA
AACCCTGTCGCTTGCAGGATTACCTCTCCCTCAATCCGGAGTCGATTCACCAAGTCATGATTCTCTTCTCCGACCGCGGGCACCCGGACGGTTACCACAACATGCATGCTTACTCCGGCC
ACACATTTAAGTTCGTCAACAAGGACGGCAAATTCCACTACGTTCAAATCCATTTCCTGAAGGATGGCGGTGCTAAGTCGCTGACGGAGCCCGAGGCTGGTCGTCTTGCGGGTGAGAACC
CCGACTACGGTATTCAGTCCCTCTTTGAGGCTATTGAGGAGGGCAATTATCCATCGTGGACGGGCTATGTG
GTACGTAGCAAGTATTTCCTAGTCCATACTGTCTCAAACTGACAGCTTT
ATAGCAAACAATGACCGCAGAGCAGGCAGAGAAATTCCGCTACAACGTCCTCGACCTGACGAAGGTCTGGCCTCACAAGGAGTTCCCGCTTCGCCCCTTCGGCAAACTTGTCTTGAACGA
GAACCCGCAGAACTACTTCGCCGAGATCGAGCAGGCTGCCTTCTCCCCATCGCACACTGTTCCCGGTATCGAGCCCTCCGCCGATCCCGTCCTCCAATCTCGTCTCTTCTCTTACCCCGA
CACCCACAG
GTGTGCATTTTCTTTCTTTGGCAGATCGTCACTTGATTCTAATTGATATACAACAGACACCGTCTGGGTACGAACTACAACCAGCTGCCAGTCAACGCACCGATCGCACCT
GTCGCGAACTTCCAACGTGATGGTGCCATGACGTTCGTCAGCCAGGGTGCGCGCCCGAACTATCAGAGCAGCTTGGTCCCCCTCAAGTACAAGCCGAAGGCGTACGAGGAGGTTAAGCAC
GAGACGTGGCTCGGCCATGCGAACGCCGATCTCAGCTTCGTCACAGAGC
GTACGTCATAATCGATGAAATCTTCATGAGACGGCAGCTGACGCTCTCGCGTGCAGTGGACTTCGAGCAGC
CCCGTGCACTCTACCAGAAGGTGTTCAGTGATACCGACCGCGATCACCTTGTGCACAACATCAAGGTGCACCTGCGCAATGCGAAGAGCATCGAGGTCAAGAACCGGACGA
GTATGATTT
ATCCTTACAATTTACTATTGTGCGATGCTGACCATGAACTCGTACTATAGTCTCTGTGTGGGCTGCCGTCGACCAGTCGCTCGGCGACCGCATCGCGGCTGCGATCGGCGTGGCGCCCGT
CCCCGCCCTGAAGGTTGCGCCCGCGTCCGAGGCGATCCGCTTCAAGACCTTCGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTAAGCAGGTCTTCAGCACCCAGGACAACGCTGTCTACACCACCTCCGTTGGTGCACCCGTAGCTCAGCCGTACGCCGCCCAGCGTATCGGTAGCGTCGGTCCTCTACTCCTC
CAGG
ACTTCCACCACATTGACCTCCTTGCGCACTTTGACCGCGAGCGTATCCCTGAGCGTGTCGTACATGCGAAGGGTGCCGGTGCTCACGGCTACTTCGAGGTGACCCACGACATCACG
GACCTGTCCTGCGCATCGATCTTCTCCAAAGTCGGTAACAAGGCGAGGGCAACTGTCCGGTTCTCGACTGTTGGTGGTGAATCTGGGTCGCCAGACACTGCCCGCGACCCAAGAG
GATTC
GCGATTAAGATCAAGACTGACGAGGGGAACCTCGACTGGGTGTTCAACAACACGCCCGTCTTCTTCATCAGGGATCCCGCAAAATTCCCCCACTTCATCCACACTCAGAAGCGCGACCCA
CAGACGCACCTCAAGGATGCGGACATGTTTTGG
GATTACCTCTCCCTCAATCCGGAGTCGATTCACCAAGTCATGATTCTCTTCTCCGACCGCGGGCACCCGGACGGTTACCACAACATG
CATGCTTACTCCGGCCACACATTTAAGTTCGTCAACAAGGACGGCAAATTCCACTACGTTCAAATCCATTTCCTGAAGGATGGCGGTGCTAAGTCGCTGACGGAGCCCGAGGCTGGTCGT
CTTGCGGGTGAGAACCCCGACTACGGTATTCAGTCCCTCTTTGAGGCTATTGAGGAGGGCAATTATCCATCGTGGACGGGCTATGTG
CAAACAATGACCGCAGAGCAGGCAGAGAAATTC
CGCTACAACGTCCTCGACCTGACGAAGGTCTGGCCTCACAAGGAGTTCCCGCTTCGCCCCTTCGGCAAACTTGTCTTGAACGAGAACCCGCAGAACTACTTCGCCGAGATCGAGCAGGCT
GCCTTCTCCCCATCGCACACTGTTCCCGGTATCGAGCCCTCCGCCGATCCCGTCCTCCAATCTCGTCTCTTCTCTTACCCCGACACCCACAG
ACACCGTCTGGGTACGAACTACAACCAG
CTGCCAGTCAACGCACCGATCGCACCTGTCGCGAACTTCCAACGTGATGGTGCCATGACGTTCGTCAGCCAGGGTGCGCGCCCGAACTATCAGAGCAGCTTGGTCCCCCTCAAGTACAAG
CCGAAGGCGTACGAGGAGGTTAAGCACGAGACGTGGCTCGGCCATGCGAACGCCGATCTCAGCTTCGTCACAGAGC
TGGACTTCGAGCAGCCCCGTGCACTCTACCAGAAGGTGTTCAGT
GATACCGACCGCGATCACCTTGTGCACAACATCAAGGTGCACCTGCGCAATGCGAAGAGCATCGAGGTCAAGAACCGGACGA
TCTCTGTGTGGGCTGCCGTCGACCAGTCGCTCGGCGAC
CGCATCGCGGCTGCGATCGGCGTGGCGCCCGTCCCCGCCCTGAAGGTTGCGCCCGCGTCCGAGGCGATCCGCTTCAAGACCTTCGCTTGA

Retrieve as FASTA