Entry information : PplDyPrx01
Entry ID 6724
Creation 2009-04-30 (Christophe Dunand)
Last sequence changes 2009-04-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Catherine Mathe (Scipio))
Peroxidase information: PplDyPrx01
Name PplDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplDyPrx01
start..stop
S start..stop
PplDyPrx02 1029 0 1..682 1..627
BaDyPrx07 677 0 1..685 1..643
PgigDyPrx04 481 1e-163 13..546 9..525
GluxDyPrx12 466 4e-157 13..550 6..569
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 203427..203585 159 N° 2 203644..203998 355 N° 3 204042..204210 169 N° 4 204262..204580 319
N° 5 204638..204871 234 N° 6 204920..205070 151 N° 7 205126..205535 410 N° 8 205589..205764 176
N° 9 205813..205861 49 N° 10 205920..205943 24 N° 11 206098..206125 28 N° 12 206177..206307 131
join(203427..203585,203644..203998,204042..204210,204262..204580,204638..204871, 204920..205070,205126..205535,205589..205764,205813..205861,205920..205943,20609 8..206125,206177..206307)


exon

Literature and cross-references PplDyPrx01
DNA ref. JGI genome:   scaffold_128 (203427..206307)
mRNA ref. JGI transcript:   99677
Protein sequence: PplDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   734
PWM (Da):   %s   80696.04  
PI (pH):   %s   6.26
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNPDFHYSKLQHIAKRAILPLLPSDPASSQKPDHELPDPKNVQGDIYLLFPKDHENFIFFAIRDVDQFRRDLANYTPTTSDDVLDNLRQITDAKASAASPSQVTRVRFGQTQIAFSRSGLNLLGQTQQTKDTHFDQGSMRNEIKALGDGGPWDPLFASGTIHGVIIVAASPMIVDADECQTATQNVKDAFKQSIYNVSEMDGNTRPGAQRGHEHFGYKDGVSQPAPRGLVKAHTGQLQCDAGVIICGYKGDPVFDNPYLSASEKRPDWTKDGTFMVFRKLEQDVIGFSNYLKSAGPQWRRFLPQDEMNKISPPLTDNEGAELFGARLVGRWKGAPLATAPYRDDASIPLDEDKVNNFDYTVKGQFGPSDSVCPFTAHTRKTAPRNLDPYLQKQFLESMLVIRAGLPYGPEVAPGEVQKDTSPRGLLFLCYQSSTENGFWQQTRSAVNEYFPTTSLVPVRQGQDPIIGGATYPSFTVTATGSVPSRGEVTINVTDSSGETQSVTGFVNTPNLSAEAIAPKYFVTSRGGEYFFVPSVSILRALAAGGTPGPFTSTPPTQEGVYRIKLYGQTPEQVWEYIPDSVPWVKLCPLDQSNDYQWRITPLGNGDYYIKSAKTDYGLVHSSYGYWNYGFPIGSAGGSIVWQINERTAGSDNFLKIREKGSNSLDSQSPQVHFYKDDIVLNCCPDTMPKGNRKSEADVSMAGPSDRSNIRMSRYERNLSAISSNTGILGL

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAACCCCGACTTCCATTATTCCAAACTTCAGCATATTGCTAAGCGAGCGATATTGCCGCTCTTACCCTCAGACCCTGCATCTTCTCAGAAGCCGGATCATGAGCTTCCAGACCCT
AAAAATGTCCAAGGCGACATATATCTACTTTTCCCGAAA
GTGAGCTGTAACACATATCGTTGCACATTGTTATCTGATGCGCTGTACCGTGCCGTAGGATCACGAGAACTTCATATTCTT
TGCTATACGCGATGTGGACCAGTTTAGGCGCGACCTCGCGAACTACACCCCGACGACATCCGATGACGTTCTTGACAACCTGCGCCAGATCACCGACGCCAAGGCCAGTGCCGCCAGTCC
GTCTCAGGTCACACGCGTTCGCTTTGGGCAGACACAGATCGCGTTCAGCCGCTCTGGCCTCAACCTCCTTGGTCAGACTCAGCAGACGAAAGACACGCACTTCGACCAGGGCTCCATGAG
GAACGAGATCAAGGCACTTGGCGACGGCGGTCCTTGGGACCCTCTCTTCGCTAGCGGCACTATTCATGGCGTCATCATCGTTGCTGCGAGCC
GTGGGTGGAGTGCGCTGTGACGTTGTTC
TATGGCATTAACCAGCCATGATTGTAGACGCTGACGAATGCCAAACCGCAACGCAGAACGTCAAGGATGCCTTCAAGCAATCGATCTACAACGTTTCAGAGATGGACGGAAATACGCGAC
CCGGAGCCCAGAGAGGTCACGAGCACTTTGGGTACAAGGACGGAGTGTCGCAACCTGCCCCTCG
GTAAGCCGAAAGTCTGTACAATCCTGAGCAGGAACCTTACATGGTTCATAGGGGAC
TGGTCAAAGCACACACAGGTCAGCTCCAGTGTGATGCCGGCGTCATCATCTGCGGCTACAAAGGCGACCCTGTCTTTGATAACCCGTACCTTTCTGCGTCAGAGAAACGCCCTGACTGGA
CAAAGGACGGGACGTTCATGGTATTCCGCAAGCTCGAACAAGACGTGATCGGGTTCAGTAACTATTTGAAATCTGCCGGGCCTCAATGGCGGCGATTCCTGCCTCAGGACGAGATGAACA
AGATCTCGCCGCCGTTGACAGACAACGAGGGCGCTGAGCTCTTTGGTGCGCGGCTCGTGGGGCGATGGAAGTCG
GTGAGCGAATCTCTTGCAGACGGCATCCGCCTCCTGATATACAGGC
CTTGGGTTTAGGGCGCCCCCTTGGCGACAGCACCGTATCGAGACGATGCGAGCATTCCCTTGGACGAAGACAAAGTCAACAACTTCGATTATACAGTGAAGGGCCAGTTCGGACCTAGCG
ACAGCGTGTGCCCGTTCACTGCGCACACGCGCAAGACTGCCCCACGCAACCTCGATCCATACTTACAGAAGCAATTCCTAGAGAGCATGCTCGTCATTCGTGCAGGGCTTCCGTATGGCC
CCGAG
GTATGATCTCGCTATCAAGTAGCAGTGGCTAGCTGATGCTGTCGATAGGTCGCACCGGGGGAAGTCCAGAAGGATACAAGCCCGCGAGGGCTCCTGTTCTTATGCTATCAGTCAT
CGACCGAAAACGGGTTCTGGCAGCAGACGCGGTCCGCGGTGAATGAATACTTTCCTACCACGTCTCTTGTTCCTGTGAGACAGG
GTTAGTACCCTGTTAGCACCCGCGGCATGCGTCTGA
TACACCTGTCTTTGCATAGGACAAGACCCAATCATTGGCGGTGCGACCTACCCGTCGTTCACAGTGACAGCCACTGGTTCCGTCCCGAGCCGCGGTGAGGTTACCATCAATGTCACCGAC
TCGTCAGGCGAGACCCAGTCTGTCACGGGCTTCGTGAACACGCCAAATCTGAGCGCAGAGGCGATTGCGCCGAAGTACTTCGTGACTTCGCGCGGTGGTGAATACTTCTTCGTGCCGTCG
GTGTCTATACTCCGTGCACTGGCGGCTGGTGGTACTCCGGGACCATTCACGAGCACGCCGCCCACGCAGGAGGGCGTGTACCGCATCAAGTTGTATGGGCAGACCCCAGAACAGGTCTGG
GAGTATATTCCTGATAGCGTGCCTTGGGTCAAGCTGTGCCCACTCGACCAGTCGAATGATTACCAGAAG
GTAAGCGAAATCATGCGGCTGTTCGGTGATGTATCGAGCTCATCGCAGCGC
AGTGGCGCATCACTCCACTCGGGAATGGCGACTACTACATCAAGAGCGCGAAGACGGATTATGGACTGGTGCATTCGTCATATGGGTACTGGAACTATGGCTTCCCTATAGGGAGCGCCG
GCGGGTCTATCGTATGGCAGATCAACGAGCGGACGGCTGGGAGCGACAATTTCCTGAA
GTATGCTCGAAATTCTTCACGTTGTGCTTTGACTGAAGAAGCTTGCAGGATCAGGGAAAAGG
GCTCCAACTCGCTAGATTCTCAGTCCCCTCAAGTC
GTAAGCCCTCTCCTTGCTCGCGCGTAGTGTATGCCAGACTCACTTGTTGGGCATGCAGGTCCACTTCTACAAGGATGATATTGTA
AGTTCGATTCATGTACAGCAAGGAGCTTCGCTGAACGCCGCGCCCGGTCTAGAATGAGCCGAACCAACGCTGGCTGATCGGGCTTGTCTGATCAGAATTGGTTGAGTTACATTCCATATA
GCTTCATGTAGCGAGATGAATCACATGCCAGGTTTTGAACTGCTGCCCAGATACAATGCGTATGTTCTGTAGTCAATGAATAGCAGATGTCTACATAAGACTGCCGCAAGCCAAGGGCAA
CCGGAAGTCAGAGGCGGATGTATCCATGGCTGGTCCGAGTGACAGAAGTAACATCAGAATGAGCAGATACGAGCGGAACCTGAGTGCAATATCATCGAATACGGGCATCCTGGGCCTGTG
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAACCCCGACTTCCATTATTCCAAACTTCAGCATATTGCTAAGCGAGCGATATTGCCGCTCTTACCCTCAGACCCTGCATCTTCTCAGAAGCCGGATCATGAGCTTCCAGACCCT
AAAAATGTCCAAGGCGACATATATCTACTTTTCCCGAAA
GATCACGAGAACTTCATATTCTTTGCTATACGCGATGTGGACCAGTTTAGGCGCGACCTCGCGAACTACACCCCGACGACA
TCCGATGACGTTCTTGACAACCTGCGCCAGATCACCGACGCCAAGGCCAGTGCCGCCAGTCCGTCTCAGGTCACACGCGTTCGCTTTGGGCAGACACAGATCGCGTTCAGCCGCTCTGGC
CTCAACCTCCTTGGTCAGACTCAGCAGACGAAAGACACGCACTTCGACCAGGGCTCCATGAGGAACGAGATCAAGGCACTTGGCGACGGCGGTCCTTGGGACCCTCTCTTCGCTAGCGGC
ACTATTCATGGCGTCATCATCGTTGCTGCGAGCC
CCATGATTGTAGACGCTGACGAATGCCAAACCGCAACGCAGAACGTCAAGGATGCCTTCAAGCAATCGATCTACAACGTTTCAGAG
ATGGACGGAAATACGCGACCCGGAGCCCAGAGAGGTCACGAGCACTTTGGGTACAAGGACGGAGTGTCGCAACCTGCCCCTCG
GGGACTGGTCAAAGCACACACAGGTCAGCTCCAGTGT
GATGCCGGCGTCATCATCTGCGGCTACAAAGGCGACCCTGTCTTTGATAACCCGTACCTTTCTGCGTCAGAGAAACGCCCTGACTGGACAAAGGACGGGACGTTCATGGTATTCCGCAAG
CTCGAACAAGACGTGATCGGGTTCAGTAACTATTTGAAATCTGCCGGGCCTCAATGGCGGCGATTCCTGCCTCAGGACGAGATGAACAAGATCTCGCCGCCGTTGACAGACAACGAGGGC
GCTGAGCTCTTTGGTGCGCGGCTCGTGGGGCGATGGAAGTCG
GGCGCCCCCTTGGCGACAGCACCGTATCGAGACGATGCGAGCATTCCCTTGGACGAAGACAAAGTCAACAACTTCGAT
TATACAGTGAAGGGCCAGTTCGGACCTAGCGACAGCGTGTGCCCGTTCACTGCGCACACGCGCAAGACTGCCCCACGCAACCTCGATCCATACTTACAGAAGCAATTCCTAGAGAGCATG
CTCGTCATTCGTGCAGGGCTTCCGTATGGCCCCGAG
GTCGCACCGGGGGAAGTCCAGAAGGATACAAGCCCGCGAGGGCTCCTGTTCTTATGCTATCAGTCATCGACCGAAAACGGGTTC
TGGCAGCAGACGCGGTCCGCGGTGAATGAATACTTTCCTACCACGTCTCTTGTTCCTGTGAGACAGG
GACAAGACCCAATCATTGGCGGTGCGACCTACCCGTCGTTCACAGTGACAGCC
ACTGGTTCCGTCCCGAGCCGCGGTGAGGTTACCATCAATGTCACCGACTCGTCAGGCGAGACCCAGTCTGTCACGGGCTTCGTGAACACGCCAAATCTGAGCGCAGAGGCGATTGCGCCG
AAGTACTTCGTGACTTCGCGCGGTGGTGAATACTTCTTCGTGCCGTCGGTGTCTATACTCCGTGCACTGGCGGCTGGTGGTACTCCGGGACCATTCACGAGCACGCCGCCCACGCAGGAG
GGCGTGTACCGCATCAAGTTGTATGGGCAGACCCCAGAACAGGTCTGGGAGTATATTCCTGATAGCGTGCCTTGGGTCAAGCTGTGCCCACTCGACCAGTCGAATGATTACCAGAAG
TGG
CGCATCACTCCACTCGGGAATGGCGACTACTACATCAAGAGCGCGAAGACGGATTATGGACTGGTGCATTCGTCATATGGGTACTGGAACTATGGCTTCCCTATAGGGAGCGCCGGCGGG
TCTATCGTATGGCAGATCAACGAGCGGACGGCTGGGAGCGACAATTTCCTGAA
GATCAGGGAAAAGGGCTCCAACTCGCTAGATTCTCAGTCCCCTCAAGTCGTCCACTTCTACAAGGAT
GATATT
GTTTTGAACTGCTGCCCAGATACAATGCCCAAGGGCAACCGGAAGTCAGAGGCGGATGTATCCATGGCTGGTCCGAGTGACAGAAGTAACATCAGAATGAGCAGATACGAGCGG
AACCTGAGTGCAATATCATCGAATACGGGCATCCTGGGCCTGTGA

Retrieve as FASTA