Entry information : PplDyPrx02
Entry ID 6725
Creation 2009-04-30 (Christophe Dunand)
Last sequence changes 2009-04-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Catherine Mathe (Scipio))
Peroxidase information: PplDyPrx02
Name PplDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplDyPrx02
start..stop
S start..stop
PplDyPrx01 1029 0 1..627 1..682
BaDyPrx07 597 0 1..639 1..651
PgigDyPrx04 404 9e-135 13..510 9..520
SlutDyPrx01 407 2e-131 5..511 2..579
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 759816..759974 159 N° 2 760031..760385 355 N° 3 760440..760596 157 N° 4 760647..760964 318
N° 5 761100..761247 148 N° 6 761296..761446 151 N° 7 761501..761844 344 N° 8 761975..762150 176
N° 9 762200..762248 49 N° 10 762308..762331 24 N° 11 762386..762424 39  
join(759816..759974,760031..760385,760440..760596,760647..760964,761100..761247, 761296..761446,761501..761844,761975..762150,762200..762248,762308..762331,76238 6..762424)


exon

Literature and cross-references PplDyPrx02
DNA ref. JGI genome:   scaffold_10 (759816..762424)
mRNA ref. JGI transcript:   105831
Protein sequence: PplDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   639
PWM (Da):   %s   70825.93  
PI (pH):   %s   9.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKPDFHHSKLQHIAKRAILPLLPSDPLSSQKPSHELPDPQNTQGDIYLLFPKDHENFVFFAIRDADHFKRDLANYTPTTSEDVLDNLRQITDAKANAAQPSQVRRVQLWQTQIAFSRSGLDLLGQTQHTKDTHFDQGSMRKELKALGDGGPWDPLFADGIIHGVIIVAASHADQCQIGTQAVRKTFKQSIHNVVEMDGNARPGARRGHEHFGYKDSVSQPAPRGLVKPHKGQLQCDAGVIICGYKGDPIFDNPYLSPSEKRPGWTKDGTFMVFRKLEQDVIGFNEYLKTAGPQWRRFLPPDEVKKISPPLTNNEGLSFLVRGLWGGGSRKGQFGSSDSVCPFTAHTRKTAPRNLDPYLQKQFLERALIVRAGLPYGPEVAPKEVQKDTSPRGLLFSCYQSSTENGFWQQTRDSVNEYFPIASLVPERGQDPIIGGATIKSLTAKVKGNETVPSSGEVTIDVTDSSGETRSVTGFVNTPNPSAEAITPQYFVTSRGGEYFFVPSVSTLRALGGSSDTPKPFTSTPPTKEGVYRIKLYGQSPEQWRITPLGNGEYHIKSAKTDYGLIHSTYGYWGYGFPVGSPGVSVVWQISQQTAGSNRFRIREKGSYPLDSQSPQVVHFYKDDINEPNQRWLFGLV

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAACCTGATTTCCATCATTCCAAACTTCAACACATTGCCAAGCGGGCGATCCTGCCGCTCTTGCCCTCAGATCCCCTATCTTCCCAGAAACCATCTCATGAGCTTCCTGACCCC
CAGAATACTCAAGGGGACATCTATCTACTCTTCCCGAAG
GTGAGTTTTGCTTACACACTGTTATACATTGTCAGCTGATATATGGTGCGTCATAGGATCATGAGAATTTCGTATTCTTTG
CCATCCGCGATGCGGATCATTTCAAGCGCGACCTTGCGAACTACACACCCACAACGTCCGAAGATGTTCTTGACAACCTTCGCCAGATCACCGACGCCAAGGCCAACGCAGCACAACCAT
CTCAGGTTCGGCGTGTGCAGTTGTGGCAGACACAGATCGCGTTCAGCCGCTCTGGTCTCGACCTCCTTGGCCAGACTCAGCATACGAAAGATACACACTTCGACCAGGGTTCTATGAGAA
AAGAGCTAAAGGCGCTTGGCGATGGCGGTCCCTGGGACCCTCTCTTCGCTGACGGTATCATTCATGGCGTTATTATCGTTGCTGCTAGCC
GTGGGTGTTGTTCACTGCCATACACCTCAT
GACATCAACAGGTCTCTGCTATAGATGCCGACCAGTGCCAGATTGGAACACAGGCCGTGAGGAAGACCTTCAAGCAATCGATCCACAACGTTGTAGAGATGGACGGAAATGCGCGGCCTG
GAGCTCGGAGAGGTCACGAGCACTTCGGCTATAAGGATAGCGTGTCGCAGCCTGCTCCTCG
GTAATTTGGAAGCCCGCACATCCCAAGAAAAACCCTGAATTGGTTCACAGGGGGCTAGT
CAAACCACACAAGGGGCAACTCCAATGCGACGCCGGTGTCATCATATGCGGCTACAAAGGGGACCCCATCTTTGATAATCCGTACCTCTCCCCGTCGGAGAAACGCCCTGGTTGGACAAA
GGACGGGACATTCATGGTCTTCCGCAAGCTAGAACAGGACGTGATTGGGTTCAATGAGTATTTGAAGACAGCTGGACCTCAGTGGCGGCGGTTCCTGCCTCCTGACGAGGTGAAAAAGAT
CTCACCGCCACTAACGAACAACGAGGGCCTGAGCTTTTTGGTGCGCGGCTTGTGGGGCGGTGGAAGTCG
GTAAGCCTCTTGTCTACGGAGTCCGCCTTAATGATAGACCTTGGGCACAGG
GCACCCCTCTGGCGACGGCACCCTACCGAGACCATCCGAGCATCCCTCTGGACGAAGACAAATTGAACAACTTTGACTACACAGTAAAGGTCAATTCGGATCTAGCGACAGCGTGTGCCC
ATTCACTGCGCACACGCGCAAGACTGCCCCGCGCAACCTCGATCCCTACCTCCAGAAGCAATTCCTGGAGCGTGCCCTCATCGTCCGTGCAGGGCTTCCATACGGCCCTGAG
GTATATTT
TCGTTACCAAGCTGTAGTGGCTAGCTGATGCTGTTAATAGGTTGCGCCGAAGGAAGTTCAGAAGGATACAAGCCCGCGAGGGCTCTTGTTCTCGTGCTATCAGTCGTCGACGGAGAACGG
GTTCTGGCAGCAGACGCGGGACTCGGTGAACGAGTACTTTCCTATCGCGTCGCTTGTGCCTGAGAGACACG
GTGAGTGTCCTACTTTCGCCCCGGCATATCTCTGACACACTTGCCTCTG
CATAGGGCAAGACCCGATTATTGGGGGCGCGACCATCAAGTCGTTAACAGCTAAAGTGAAAGGGAATGAAACTGTCCCGAGCAGCGGTGAGGTGACCATCGACGTCACAGACTCCTCAGG
CGAGACTCGGTCTGTCACGGGCTTCGTGAATACGCCAAATCCGAGCGCAGAGGCGATCACGCCGCAATACTTTGTGACCTCGCGCGGCGGCGAATACTTCTTCGTGCCGTCGGTGTCCAC
ACTGCGTGCACTGGGGGGTAGCTCTGATACTCCGAAACCGTTTACAAGCACGCCGCCCACGAAAGAGGGCGTGTACCGCATCAAGCTGTATGGGCAGAGTCCGGAGCAG
GTCTGGGAGTA
CATTCCTGATGGCCCGTGCCTTGGGTCAAGCTTTGCCCACTCGACATGTCGAATGATTACCAGAAGGGAAGCAGGGATCCGAAGATGTTCGTTGTTATGTCGAACTCATCGCGGCGTAGT
GGCGCATCACTCCGCTGGGGAATGGCGAGTACCACATCAAGAGCGCGAAGACGGATTATGGCCTGATACATTCGACATATGGATACTGGGGTTATGGTTTCCCTGTAGGAAGCCCCGGCG
TATCCGTCGTGTGGCAGATCAGCCAGCAGACAGCTGGAAGCAACAGGTTCTTGAG
GTAAGCTTTGGAATCCGCCACGTTGCGCTATGACTGAGGAAACTTGCAGGATCAGGGAAAAGGGC
TCTTATCCGCTGGATTCTCAGTCCCCTCAAGTC
GTAAGCAATCTGCCTTCCTCGCGTATAATATATATCGAACTTACTTGACGGATATGTAGGTGCACTTCTACAAGGATGACATTGTAA
ACTCATTCCACGTGCAGCGAGTACCATTGCTGATCTCGTATCCGATATAGAATGAGCCGAACCAACGCTGGCTGTTCGGGCTTGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAACCTGATTTCCATCATTCCAAACTTCAACACATTGCCAAGCGGGCGATCCTGCCGCTCTTGCCCTCAGATCCCCTATCTTCCCAGAAACCATCTCATGAGCTTCCTGACCCC
CAGAATACTCAAGGGGACATCTATCTACTCTTCCCGAAG
GATCATGAGAATTTCGTATTCTTTGCCATCCGCGATGCGGATCATTTCAAGCGCGACCTTGCGAACTACACACCCACAACG
TCCGAAGATGTTCTTGACAACCTTCGCCAGATCACCGACGCCAAGGCCAACGCAGCACAACCATCTCAGGTTCGGCGTGTGCAGTTGTGGCAGACACAGATCGCGTTCAGCCGCTCTGGT
CTCGACCTCCTTGGCCAGACTCAGCATACGAAAGATACACACTTCGACCAGGGTTCTATGAGAAAAGAGCTAAAGGCGCTTGGCGATGGCGGTCCCTGGGACCCTCTCTTCGCTGACGGT
ATCATTCATGGCGTTATTATCGTTGCTGCTAGCC
ATGCCGACCAGTGCCAGATTGGAACACAGGCCGTGAGGAAGACCTTCAAGCAATCGATCCACAACGTTGTAGAGATGGACGGAAAT
GCGCGGCCTGGAGCTCGGAGAGGTCACGAGCACTTCGGCTATAAGGATAGCGTGTCGCAGCCTGCTCCTCG
GGGGCTAGTCAAACCACACAAGGGGCAACTCCAATGCGACGCCGGTGTC
ATCATATGCGGCTACAAAGGGGACCCCATCTTTGATAATCCGTACCTCTCCCCGTCGGAGAAACGCCCTGGTTGGACAAAGGACGGGACATTCATGGTCTTCCGCAAGCTAGAACAGGAC
GTGATTGGGTTCAATGAGTATTTGAAGACAGCTGGACCTCAGTGGCGGCGGTTCCTGCCTCCTGACGAGGTGAAAAAGATCTCACCGCCACTAACGAACAACGAGGGCCTGAGCTTTTTG
GTGCGCGGCTTGTGGGGCGGTGGAAGTCG
TAAAGGTCAATTCGGATCTAGCGACAGCGTGTGCCCATTCACTGCGCACACGCGCAAGACTGCCCCGCGCAACCTCGATCCCTACCTCCAG
AAGCAATTCCTGGAGCGTGCCCTCATCGTCCGTGCAGGGCTTCCATACGGCCCTGAG
GTTGCGCCGAAGGAAGTTCAGAAGGATACAAGCCCGCGAGGGCTCTTGTTCTCGTGCTATCAG
TCGTCGACGGAGAACGGGTTCTGGCAGCAGACGCGGGACTCGGTGAACGAGTACTTTCCTATCGCGTCGCTTGTGCCTGAGAGACACG
GGCAAGACCCGATTATTGGGGGCGCGACCATC
AAGTCGTTAACAGCTAAAGTGAAAGGGAATGAAACTGTCCCGAGCAGCGGTGAGGTGACCATCGACGTCACAGACTCCTCAGGCGAGACTCGGTCTGTCACGGGCTTCGTGAATACGCCA
AATCCGAGCGCAGAGGCGATCACGCCGCAATACTTTGTGACCTCGCGCGGCGGCGAATACTTCTTCGTGCCGTCGGTGTCCACACTGCGTGCACTGGGGGGTAGCTCTGATACTCCGAAA
CCGTTTACAAGCACGCCGCCCACGAAAGAGGGCGTGTACCGCATCAAGCTGTATGGGCAGAGTCCGGAGCAG
TGGCGCATCACTCCGCTGGGGAATGGCGAGTACCACATCAAGAGCGCG
AAGACGGATTATGGCCTGATACATTCGACATATGGATACTGGGGTTATGGTTTCCCTGTAGGAAGCCCCGGCGTATCCGTCGTGTGGCAGATCAGCCAGCAGACAGCTGGAAGCAACAGG
TTCTTGAG
GATCAGGGAAAAGGGCTCTTATCCGCTGGATTCTCAGTCCCCTCAAGTCGTGCACTTCTACAAGGATGACATTAATGAGCCGAACCAACGCTGGCTGTTCGGGCTTGTCTGA

Retrieve as FASTA