Entry information : PplGPx01
Entry ID 6726
Creation 2009-04-30 (Christophe Dunand)
Last sequence changes 2011-11-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Catherine Mathe (Scipio))
Peroxidase information: PplGPx01
Name PplGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplGPx01
start..stop
S start..stop
PplGPx02 486 6e-178 2..237 1..236
TcamGPx 292 3e-102 79..237 1..159
GtraGPx01 293 6e-102 38..237 22..220
NlepGPx01 288 5e-100 59..237 41..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 208171..208511 341 N° 2 208079..208101 23 N° 3 207934..208001 68 N° 4 207687..207860 174
N° 5 207507..207614 108  
complement(join(207507..207614,207687..207860,207934..208001,208079..208101,2081 71..208511))


exon

Literature and cross-references PplGPx01
DNA ref. JGI genome:   scaffold_87 (208511..207507)
mRNA ref. JGI transcript:   112705
Protein sequence: PplGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   26077.56  
PI (pH):   %s   9.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMLLLRPVRTGLTTPGPSRSLTTVARLSGSLIFTSKWLLLRSHLCPDGLTRAHTAVAPPSRRTIHIHDAKANLTHNSTMSTFYDLKAELPGGKTYDFSELRGKVVLIVNVASKCGFTPQYGLQTLYEKHKDQGFVILGFPCNFGGQEPENDEAIGQFCQLNHGVSFPLMKKSDVNGDGANDVYKYLKTQKAGLLGLTRIKWNFEKFLIDKNGNVVQRWASTTSPDAIDAEVAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGCTGCTGCTGCGTCCCGTTCGCACCGGTCTGACAACTCCCGGACCATCCCGCTCCTTGACCACCGTTGCCCGACTTTCTGGCAGCCTCATATTCACATCCAAGTGGTTGCTGTTG
CGTTCACATCTTTGCCCAGACGGTCTCACTCGCGCTCACACTGCAGTTGCTCCCCCTTCTCGCCGCACTATTCACATTCACGACGCGAAGGCAAACCTGACTCACAACAGTACCATGTCT
ACCTTCTACGATCTCAAGGCCGAGCTGCCTGGCGGGAAGACATACGACTTTAGCGAGCTGCGCGGCAAAGTCGTCCTCATTGTTAATGTCGCGTCCAAATG
GTGCGCACCACGCTGTACG
GTATTCCCTGCCGTCTTGCTCACGATCTGATCTGATCGGCTGCTACTCAGTGGGTTCACCCCACAATACAAAGGTGCGCTCGTCGGTTGCTGTCTTAGGGTATAATGTTGTTGATGGCTG
TCCCTGTGCCGTACTATGTCTGAACGCCAGGCCTCCAGACACTGTACGAGAAGCACAAGGACCAGGGCTTTGTCATCCTCGGCTTCCCCTGCAACCAGGTGGGCCATGCATCTCTCCTAA
CATTTTGGCTTCCTATCCCTTACGCGCATCCCACCTGTTCCCCTTGCGCAGTTCGGTGGCCAAGAGCCCGAGAACGATGAGGCGATCGGCCAATTCTGCCAGCTGAACCACGGCGTATCG
TTCCCGTTGATGAAAAAGTCGGACGTGAACGGCGACGGCGCCAACGACGTATACAAGTACCTCAAGACCCAGAAGGCGGGCTTGTTGGGTCTCACGAGGATAAAG
GTGTGTCCGCGTTTT
GCGTTGGTTTGATGTGTCATGTGCGAGGCCGGCTGACTGGGTGGCCGCGGCACGCAGTGGAACTTTGAAAAGTTCCTGATTGACAAGAACGGGAACGTCGTGCAGCGCTGGGCGTCGACG
ACGTCGCCCGACGCGATCGACGCTGAGGTCGCGAAGTTATTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGCTGCTGCTGCGTCCCGTTCGCACCGGTCTGACAACTCCCGGACCATCCCGCTCCTTGACCACCGTTGCCCGACTTTCTGGCAGCCTCATATTCACATCCAAGTGGTTGCTGTTG
CGTTCACATCTTTGCCCAGACGGTCTCACTCGCGCTCACACTGCAGTTGCTCCCCCTTCTCGCCGCACTATTCACATTCACGACGCGAAGGCAAACCTGACTCACAACAGTACCATGTCT
ACCTTCTACGATCTCAAGGCCGAGCTGCCTGGCGGGAAGACATACGACTTTAGCGAGCTGCGCGGCAAAGTCGTCCTCATTGTTAATGTCGCGTCCAAATG
TGGGTTCACCCCACAATAC
AAAG
GCCTCCAGACACTGTACGAGAAGCACAAGGACCAGGGCTTTGTCATCCTCGGCTTCCCCTGCAACCAGTTCGGTGGCCAAGAGCCCGAGAACGATGAGGCGATCGGCCAATTCTGC
CAGCTGAACCACGGCGTATCGTTCCCGTTGATGAAAAAGTCGGACGTGAACGGCGACGGCGCCAACGACGTATACAAGTACCTCAAGACCCAGAAGGCGGGCTTGTTGGGTCTCACGAGG
ATAAAG
TGGAACTTTGAAAAGTTCCTGATTGACAAGAACGGGAACGTCGTGCAGCGCTGGGCGTCGACGACGTCGCCCGACGCGATCGACGCTGAGGTCGCGAAGTTATTGTGA

Retrieve as FASTA