Entry information : PplGPx02
Entry ID 6727
Creation 2009-04-30 (Christophe Dunand)
Last sequence changes 2011-11-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: PplGPx02
Name PplGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplGPx02
start..stop
S start..stop
PplGPx01 486 6e-178 1..236 2..237
GtraGPx01 295 2e-102 37..236 22..220
TcamGPx 292 2e-102 78..236 1..159
NlepGPx01 289 3e-100 58..236 41..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 328684..329021 338 N° 2 329091..329113 23 N° 3 329197..329264 68 N° 4 329338..329511 174
N° 5 329584..329691 108  
join(328684..329021,329091..329113,329197..329264,329338..329511,329584..329691)


exon

Literature and cross-references PplGPx02
DNA ref. JGI genome:   scaffold_20 (328684..329691)
mRNA ref. JGI transcript:   117609
EST ref. GenBank:   FL606997.1
Protein sequence: PplGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   25948.53  
PI (pH):   %s   9.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLLRSVRTGLTTPGPSRSLTTVARISGSLIFTSKWLLLRSHLCPDGLTRAHIAVAPPSRRTIHIHDAKANLTHNSTMSTFYDLKAELPGGKTYDFSELRGKVVLIVNVASKCGFTPQYGLQTLYEKHKDQGFVILGFPCNFGGQEPENDEAIGQFCQLNHGVSFPLMKKSDVNGDGANDVYKYLKTQKAGLLGLTRIKWNFEKFLIDKNGNVVQRWASTTSPDAIDAEVAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 1 EST (confirmed the gene duplication).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGCTGCGTTCCGTCCGCACCGGTCTGACAACTCCCGGACCATCCCGCTCCTTGACCACCGTTGCCCGGATTTCTGGCAGCCTCATATTCACATCCAAGTGGTTGCTGTTGCGT
TCACATCTTTGCCCAGACGGTCTCACTCGCGCGCACATTGCAGTTGCTCCCCCTTCTCGCCGCACTATTCACATTCACGACGCGAAGGCAAACCTGACTCACAACAGTACCATGTCTACC
TTCTACGATCTCAAGGCCGAGCTGCCTGGCGGGAAGACATACGACTTTAGCGAGCTGCGCGGCAAAGTTGTCCTCATCGTTAATGTCGCGTCCAAATG
GTGCGCACCACGCTGTACGGTA
TCCCCTGCCGTCTTGCTCACGATCTGATCTGATCGGCTGCTACTCAGTGGGTTCACCCCACAATACAAAGGTGCGCTCGTCGGTTGCTGTCTTAGGGTATAATGTTGTTGATGGCTGTCC
CTGTGCCAACCCCGTCCTACGTCTGAACGCCAGGCCTCCAGACACTGTACGAGAAGCACAAGGACCAGGGCTTTGTCATCCTCGGCTTCCCCTGCAACCAGGTGGGCCATGCATCTCTCC
TAACATTTTGGCTTCCTATCCCTTACGCGCATCCCACCTGTTCCCCTTGCGCAGTTCGGTGGCCAAGAGCCCGAGAACGATGAGGCGATCGGCCAATTCTGCCAGCTGAACCACGGCGTA
TCGTTCCCGTTGATGAAAAAGTCGGACGTGAACGGCGACGGCGCCAACGACGTATACAAGTACCTCAAGACCCAGAAGGCGGGATTGTTGGGTCTCACAAGGATAAAG
GTGCGTCCGCGT
TTTGCATTAATTTGATGTGCCATGTGCGAGGCCGGCTGACTGGGTGGCCGCGGCACGCAGTGGAACTTTGAAAAGTTCCTGATTGACAAGAACGGGAACGTCGTGCAGCGCTGGGCGTCG
ACGACGTCGCCCGACGCGATCGACGCTGAGGTCGCGAAGTTATTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGCTGCGTTCCGTCCGCACCGGTCTGACAACTCCCGGACCATCCCGCTCCTTGACCACCGTTGCCCGGATTTCTGGCAGCCTCATATTCACATCCAAGTGGTTGCTGTTGCGT
TCACATCTTTGCCCAGACGGTCTCACTCGCGCGCACATTGCAGTTGCTCCCCCTTCTCGCCGCACTATTCACATTCACGACGCGAAGGCAAACCTGACTCACAACAGTACCATGTCTACC
TTCTACGATCTCAAGGCCGAGCTGCCTGGCGGGAAGACATACGACTTTAGCGAGCTGCGCGGCAAAGTTGTCCTCATCGTTAATGTCGCGTCCAAATG
TGGGTTCACCCCACAATACAAA
G
GCCTCCAGACACTGTACGAGAAGCACAAGGACCAGGGCTTTGTCATCCTCGGCTTCCCCTGCAACCAGTTCGGTGGCCAAGAGCCCGAGAACGATGAGGCGATCGGCCAATTCTGCCAG
CTGAACCACGGCGTATCGTTCCCGTTGATGAAAAAGTCGGACGTGAACGGCGACGGCGCCAACGACGTATACAAGTACCTCAAGACCCAGAAGGCGGGATTGTTGGGTCTCACAAGGATA
AAG
TGGAACTTTGAAAAGTTCCTGATTGACAAGAACGGGAACGTCGTGCAGCGCTGGGCGTCGACGACGTCGCCCGACGCGATCGACGCTGAGGTCGCGAAGTTATTGTGA

Retrieve as FASTA