Entry information : PcGPx
Entry ID 6728
Creation 2009-04-30 (Christophe Dunand)
Last sequence changes 2009-04-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcGPx
Name PcGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcGPx
start..stop
S start..stop
BaGPx01 294 1e-103 1..159 55..213
TcamGPx 283 3e-100 1..159 1..159
PcarGPx01 283 6e-100 2..159 5..162
CuniGPx01 280 9e-99 1..159 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 337616..337722 107 N° 2 337471..337561 91 N° 3 337244..337417 174 N° 4 337083..337190 108
complement(join(337083..337190,337244..337417,337471..337561,337616..337722))


exon

Literature and cross-references PcGPx
DNA ref. JGI genome:   scaffold_16 (337722..337083)
mRNA ref. JGI transcript:   130274
Protein sequence: PcGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159
PWM (Da):   %s   17680.98  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSEFYKLKAELPNGETYDFEQLKGKVVLIVNTASKCGFTPQYKGLEALYQKYKDQGLVILGFPCNFGGQEPGTDADVASFCEKNFGVTFPLMKKSDVNGDNTNEVFKYLKSQKAGLLGLTRIKWNFEKFLVDKEGNVVHRWASTTSPESIDAEIAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGAATTCTACAAACTCAAGGCCGAGCTGCCCAACGGCGAGACATACGACTTTGAGCAGCTCAAGGGCAAGGTCGTCCTCATCGTGAACACTGCATCCAAGTGGTGCGTGACTCGC
TGCATGGCTGCGCATCCCCTGAGCTAACCCCCACGCCGCAGCGGCTTCACGCCACAGTACAAGGGCCTCGAGGCCCTCTACCAGAAGTACAAGGACCAGGGCCTCGTGATCCTCGGCTTC
CCGTGCAACCAG
GTGCGTCGACGCGTCCCCGCTCGTCTCGCCCCATACTCACCGGTGTGCTTCAGTTTGGCGGGCAGGAGCCCGGCACGGACGCAGACGTCGCAAGCTTCTGCGAGAAGA
ACTTCGGCGTGACGTTCCCGCTGATGAAGAAGTCGGACGTGAACGGCGACAACACGAACGAGGTCTTCAAGTACCTCAAGAGTCAGAAGGCAGGCCTCCTCGGTCTGACGCGTATCAAG
G
TGCGCATTGCTGTCTCTGATATCAGGCCCAGAATTGACGAGGGCTTCTGCAGTGGAACTTTGAGAAGTTCTTGGTCGACAAGGAAGGCAACGTCGTCCACCGCTGGGCGTCGACGACCTC
TCCAGAGTCTATCGACGCGGAGATCGCGAAGTTGCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGAATTCTACAAACTCAAGGCCGAGCTGCCCAACGGCGAGACATACGACTTTGAGCAGCTCAAGGGCAAGGTCGTCCTCATCGTGAACACTGCATCCAAGTGCGGCTTCACGCCA
CAGTACAAGGGCCTCGAGGCCCTCTACCAGAAGTACAAGGACCAGGGCCTCGTGATCCTCGGCTTCCCGTGCAACCAG
TTTGGCGGGCAGGAGCCCGGCACGGACGCAGACGTCGCAAGC
TTCTGCGAGAAGAACTTCGGCGTGACGTTCCCGCTGATGAAGAAGTCGGACGTGAACGGCGACAACACGAACGAGGTCTTCAAGTACCTCAAGAGTCAGAAGGCAGGCCTCCTCGGTCTG
ACGCGTATCAAG
TGGAACTTTGAGAAGTTCTTGGTCGACAAGGAAGGCAACGTCGTCCACCGCTGGGCGTCGACGACCTCTCCAGAGTCTATCGACGCGGAGATCGCGAAGTTGCTGTGA

Retrieve as FASTA