Entry information : LbiHalPrx04
Entry ID 6733
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiHalPrx04
Name LbiHalPrx04
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiHalPrx04
start..stop
S start..stop
AbHalPrx02_bisporus 321 7e-112 5..251 11..267
CcinHalPrx03 291 4e-100 14..250 13..263
SlutHalPrx03 213 1e-69 1..248 1..244
PinvHalPrx03 206 2e-66 1..244 9..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3627876..3628036 161 N° 2 3628090..3628690 601  
join(3627876..3628036,3628090..3628690)


exon

Literature and cross-references LbiHalPrx04
Literature Martin et al., The genome of Laccaria bicolor provides insights into mycorrhizal symbiosis. Nature 452 (7183), 88-92 (2008)
DNA ref. JGI genome:   LG_10 (3627876..3628690)
mRNA ref. GenBank:   XM_001887861
Protein sequence: LbiHalPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   253
PWM (Da):   %s   27556.07  
PI (pH):   %s   7.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSALPESHPAVHEHKGKTCPVTGQTHDFCAAQPEDSRSPCPALNTMANHGYISRNGKNISASEIVTGLKACYGLSTPLALFLSHVGFLVLRKTFRRVSLFEIGKHGQVEHNASLVHHDTPAGEVYAPIEIDAGLVDKLIDDVEGGEKMNAVDVARARIRREKQSPVLDGVHAEIARGEMAIILGVWEEGAGTDKLGIPAAWMRRWIQEEKLPDGWRPTRTQGLLDTVKRSKAIRTAMEDFRKAEAEAAKEN

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCTCTGCCCTCCCAGAATCCCATCCAGCGGTGCACGAACACAAGGGCAAGACCTGCCCCGTTACAGGACAAACACACGATTTCTGTGCCGCCCAACCAGAAGATAGCCGCTCC
CCTTGTCCGGCGCTCAACACCATGGCCAATCATGGTTACAT
GTACGTGGATTCGGGCCCCTAACCCATCTTCGTCACAACCTCAACGTTCGTAGTTCCCGTAACGGCAAAAACATCAGCG
CCTCGGAAATCGTCACCGGGTTGAAAGCATGCTACGGGCTCTCAACGCCCTTAGCGCTCTTCCTTTCCCATGTTGGATTTCTCGTCCTGCGGAAGACTTTCCGCCGAGTTTCGTTATTTG
AAATCGGGAAACACGGCCAAGTCGAGCACAACGCGAGTCTGGTGCATCACGATACTCCCGCCGGTGAAGTGTACGCCCCGATAGAGATCGACGCAGGATTAGTGGACAAGTTAATCGATG
ACGTCGAAGGGGGCGAGAAGATGAACGCAGTAGATGTTGCGAGAGCACGGATACGAAGGGAGAAGCAAAGCCCAGTGTTGGACGGGGTGCATGCTGAGATTGCGAGGGGGGAGATGGCAA
TTATACTAGGAGTGTGGGAGGAGGGGGCGGGGACGGATAAACTAGGGATTCCGGCTGCTTGGATGCGAAGGTGGATCCAAGAAGAGAAGTTGCCCGACGGGTGGAGGCCTACGCGGACGC
AGGGGTTGTTGGACACGGTGAAGAGGTCCAAGGCAATCCGCACGGCGATGGAGGACTTCAGGAAGGCCGAGGCCGAAGCGGCTAAAGAGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCTCTGCCCTCCCAGAATCCCATCCAGCGGTGCACGAACACAAGGGCAAGACCTGCCCCGTTACAGGACAAACACACGATTTCTGTGCCGCCCAACCAGAAGATAGCCGCTCC
CCTTGTCCGGCGCTCAACACCATGGCCAATCATGGTTACAT
TTCCCGTAACGGCAAAAACATCAGCGCCTCGGAAATCGTCACCGGGTTGAAAGCATGCTACGGGCTCTCAACGCCCTTA
GCGCTCTTCCTTTCCCATGTTGGATTTCTCGTCCTGCGGAAGACTTTCCGCCGAGTTTCGTTATTTGAAATCGGGAAACACGGCCAAGTCGAGCACAACGCGAGTCTGGTGCATCACGAT
ACTCCCGCCGGTGAAGTGTACGCCCCGATAGAGATCGACGCAGGATTAGTGGACAAGTTAATCGATGACGTCGAAGGGGGCGAGAAGATGAACGCAGTAGATGTTGCGAGAGCACGGATA
CGAAGGGAGAAGCAAAGCCCAGTGTTGGACGGGGTGCATGCTGAGATTGCGAGGGGGGAGATGGCAATTATACTAGGAGTGTGGGAGGAGGGGGCGGGGACGGATAAACTAGGGATTCCG
GCTGCTTGGATGCGAAGGTGGATCCAAGAAGAGAAGTTGCCCGACGGGTGGAGGCCTACGCGGACGCAGGGGTTGTTGGACACGGTGAAGAGGTCCAAGGCAATCCGCACGGCGATGGAG
GACTTCAGGAAGGCCGAGGCCGAAGCGGCTAAAGAGAATTAA

Retrieve as FASTA