Entry information : PplHalPrx05
Entry ID 6734
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Catherine Mathe (Scipio))
Peroxidase information: PplHalPrx05
Name PplHalPrx05
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplHalPrx05
start..stop
S start..stop
AbHalPrx02_bisporus 180 3e-56 49..267 31..264
SbreHalPrx03 173 1e-53 45..264 25..248
SlutHalPrx03 169 4e-52 45..264 21..244
LbiHalPrx04 167 3e-51 45..265 22..247
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 435729..435823 95 N° 2 435539..435673 135 N° 3 434887..435490 604  
complement(join(434887..435490,435539..435673,435729..435823))


exon

Literature and cross-references PplHalPrx05
DNA ref. JGI genome:   scaffold_18 (435823..434887)
mRNA ref. JGI transcript:   93549
Protein sequence: PplHalPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   277
PWM (Da):   %s   31290.03 Transmb domain:   %s   i13-35o
PI (pH):   %s   8.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKMSLHSTSLHRLLLKYALVTALMAVVVKMITAVHDLTLIDVPPFSLDTHPFVPPKSSDSRSPCPALNTLANHGMLRHDGREITRTDYIRALRQGYNLSLPLATFLTISGHVLLSQYSTLSLSDLGRHNFIEHNASLGHWDAVGDEEYAPDKTSSRLISQLVNQSTDGRTMSMRDFSAARILREKAYSRPLDSLHEEIARGEMSMVLGIFGRGNESVPISWIEEWWKNETFPSDFVPEREQTLWKTVRGSWKINMLMRTMRAEAGIQTWLLRHLVW

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). No EST. Strain="Mad-698-R". Also found in scaffold_108 (282326..283261).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGATGTCACTGCACTCTACGTCTCTCCATCGCCTACTGCTCAAGTACGCGCTAGTGACGGCGCTGATGGCTGTTGTAGTGAAGATGATGTGCGTGTCCTGGTGAAGGCTAACG
AAATCAGCACTGACGCCGTCTTAATGACAGAACGGCTGTTCATGACCTTACGCTTATCGACGTGCCTCCCTTCTCTCTTGACACGCATCCCTTTGTTCCTCCCAAATCGTCCGATAGTCG
CTCGCCGTGCCCGGCACTTAATACTCTAGCGAATCATGGCATGCT
GTAAGTGCAGTCTTCCATTGCTTGCCATGTTGCTCACACCTCGCGTAGGCGGCACGACGGGCGTGAGATCACACG
CACAGACTACATTCGCGCTCTCCGCCAAGGATACAATCTTTCGCTTCCGCTGGCCACCTTCCTGACCATAAGTGGACACGTATTACTCTCGCAATACTCCACATTGTCGTTATCGGACCT
GGGACGTCACAACTTCATCGAGCACAACGCGTCGCTTGGCCACTGGGATGCCGTAGGAGATGAAGAGTACGCTCCCGACAAGACAAGTTCTCGGCTCATCTCCCAGCTCGTGAACCAGTC
GACGGATGGGCGGACGATGTCGATGCGCGACTTTTCCGCGGCGCGCATACTTCGCGAGAAGGCCTATTCTCGTCCACTAGACTCATTGCACGAGGAGATCGCGCGCGGGGAGATGTCCAT
GGTGCTCGGCATCTTTGGCCGCGGTAACGAGTCCGTACCGATCTCATGGATCGAGGAGTGGTGGAAGAACGAGACATTCCCGAGCGACTTCGTTCCCGAGCGTGAGCAGACGCTGTGGAA
GACCGTGCGCGGGTCCTGGAAGATCAACATGCTAATGCGCACGATGAGGGCGGAGGCTGGGATCCAAACCTGGCTATTGCGCCATCTAGTCTGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGATGTCACTGCACTCTACGTCTCTCCATCGCCTACTGCTCAAGTACGCGCTAGTGACGGCGCTGATGGCTGTTGTAGTGAAGATGATAACGGCTGTTCATGACCTTACGCTT
ATCGACGTGCCTCCCTTCTCTCTTGACACGCATCCCTTTGTTCCTCCCAAATCGTCCGATAGTCGCTCGCCGTGCCCGGCACTTAATACTCTAGCGAATCATGGCATGCT
GCGGCACGAC
GGGCGTGAGATCACACGCACAGACTACATTCGCGCTCTCCGCCAAGGATACAATCTTTCGCTTCCGCTGGCCACCTTCCTGACCATAAGTGGACACGTATTACTCTCGCAATACTCCACA
TTGTCGTTATCGGACCTGGGACGTCACAACTTCATCGAGCACAACGCGTCGCTTGGCCACTGGGATGCCGTAGGAGATGAAGAGTACGCTCCCGACAAGACAAGTTCTCGGCTCATCTCC
CAGCTCGTGAACCAGTCGACGGATGGGCGGACGATGTCGATGCGCGACTTTTCCGCGGCGCGCATACTTCGCGAGAAGGCCTATTCTCGTCCACTAGACTCATTGCACGAGGAGATCGCG
CGCGGGGAGATGTCCATGGTGCTCGGCATCTTTGGCCGCGGTAACGAGTCCGTACCGATCTCATGGATCGAGGAGTGGTGGAAGAACGAGACATTCCCGAGCGACTTCGTTCCCGAGCGT
GAGCAGACGCTGTGGAAGACCGTGCGCGGGTCCTGGAAGATCAACATGCTAATGCGCACGATGAGGGCGGAGGCTGGGATCCAAACCTGGCTATTGCGCCATCTAGTCTGGTGA

Retrieve as FASTA