Entry information : Ppl2CysPrx01-1A (Ppl2CysPrx01a)
Entry ID 6739
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Christophe Dunand)
Peroxidase information: Ppl2CysPrx01-1A (Ppl2CysPrx01a)
Name (synonym) Ppl2CysPrx01-1A (Ppl2CysPrx01a)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ppl2CysPrx01-1A
start..stop
S start..stop
Ppl2CysPrx01-1B 434 4e-158 1..210 1..210
Athi2CysPrx01 350 7e-125 1..210 1..217
Ccin2CysPrx 350 9e-125 1..210 1..211
Pc2CysPrx01-1 344 2e-122 1..210 1..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 85958..86058 101 N° 2 86119..86142 24 N° 3 86189..86274 86 N° 4 86334..86532 199
N° 5 86590..86668 79 N° 6 86726..86869 144  
join(85958..86058,86119..86142,86189..86274,86334..86532,86590..86668,86726..868 69)


exon

Literature and cross-references Ppl2CysPrx01-1A (Ppl2CysPrx01a)
DNA ref. JGI genome:   scaffold_21 (85958..86869)
mRNA ref. JGI transcript:   113864
Protein sequence: Ppl2CysPrx01-1A (Ppl2CysPrx01a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   210
PWM (Da):   %s   23121.83  
PI (pH):   %s   5.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVATVQKPAPGFKAPAVVDGLFQDISLSDYLGQWVVLFFYPLDFTFVCPTEILAFNDALPQFKQLNTTVSVSTDSHFSHFAWATQDRKQGGLGPDLKLPMIADKSMSISRDYGVLIEEEGIALRGLFLIDPKGTLRQITINDLPVGRSVDETIRLVKAFQFDEHGEVCPANWTEGSQTIKTDPHGKLEYFSTAGGANGEQSRKRPRID*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 24 ESTs. Also detected in scaffold_179
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCCACTGTTCAAAAGCCCGCCCCCGGTTTCAAGGCCCCTGCTGTCGTGGATGGCCTCTTCCAGGACATCTCGTTGTCAGATTATCTCGGTCAATGGTGAGATCGACATAGCCAC
TCGTATTAATAGCCCTTTTGGCTCATGATTATCTTTGTCAGGGTGGTTCTCTTCTTCTACCCTCTGTGCGTATTCCCAGGACTGCCAAAACGCGTAACTGACCTGCCCCAGCGATTTCAC
GTTTGTGTGCCCGACCGAGATTCTTGCGTTCAATGATGCTCTGCCCCAATTCAAGCAGCTGAACACCACCGTCCTCA
GTATGGCATCTCTTTTAGACTCGGAACAGGCACACCTCATCGC
TGGTCTGGTCATGCAGGTGTCTCGACGGACTCGCACTTTTCCCACTTCGCGTGGGCGACGCAGGACCGCAAGCAGGGTGGTCTCGGTCCCGACCTCAAGCTGCCCATGATCGCGGACAAG
AGCATGTCGATCTCCCGTGACTACGGCGTTCTCATCGAGGAGGAGGGCATTGCTCTCCGCGGCCTGTTCCTCATCGACCCCAAGGGCACGCTCAG
GTGTGTAAAACCATGAGCTGGCAAT
ATGTGGCGTCGGCGCTCATATCTATGGCCTAGGCAAATCACCATTAACGACCTGCCTGTTGGCCGCTCCGTCGACGAGACCATCCGTCTCGTCAAGGCCTTTCAGTTCACCGTGCGTTCC
TCTGGCTTGGCACTGCCCTTGCTGTCGACACTGACTGAACACTTGCAGGACGAGCACGGTGAAGTGTGCCCTGCCAACTGGACTGAGGGTAGCCAGACGATCAAGACGGACCCTCACGGC
AAGCTGGAGTACTTCAGCACCGCTGGTGGCGCAAATGGCGAGCAATCCCGCAAGCGTCCACGTATAGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCCACTGTTCAAAAGCCCGCCCCCGGTTTCAAGGCCCCTGCTGTCGTGGATGGCCTCTTCCAGGACATCTCGTTGTCAGATTATCTCGGTCAATGGGTGGTTCTCTTCTTCTAC
CCTCT
CGATTTCACGTTTGTGTGCCCGACCGAGATTCTTGCGTTCAATGATGCTCTGCCCCAATTCAAGCAGCTGAACACCACCGTCCTCAGTGTCTCGACGGACTCGCACTTTTCCCAC
TTCGCGTGGGCGACGCAGGACCGCAAGCAGGGTGGTCTCGGTCCCGACCTCAAGCTGCCCATGATCGCGGACAAGAGCATGTCGATCTCCCGTGACTACGGCGTTCTCATCGAGGAGGAG
GGCATTGCTCTCCGCGGCCTGTTCCTCATCGACCCCAAGGGCACGCTCAG
GCAAATCACCATTAACGACCTGCCTGTTGGCCGCTCCGTCGACGAGACCATCCGTCTCGTCAAGGCCTTT
CAGTTCACC
GACGAGCACGGTGAAGTGTGCCCTGCCAACTGGACTGAGGGTAGCCAGACGATCAAGACGGACCCTCACGGCAAGCTGGAGTACTTCAGCACCGCTGGTGGCGCAAATGGC
GAGCAATCCCGCAAGCGTCCACGTATAGACTGA

Retrieve as FASTA