Entry information : PplPrxII01-1A (PplPrxII01a)
Entry ID 6740
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Christophe Dunand)
Peroxidase information: PplPrxII01-1A (PplPrxII01a)
Name (synonym) PplPrxII01-1A (PplPrxII01a)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplPrxII01-1A
start..stop
S start..stop
PplPrxII01-1B 339 1e-121 1..171 1..171
LbiPrxII 255 1e-88 4..171 2..169
SbrePrxII01 253 1e-87 5..171 6..172
SlutPrxII01 251 4e-87 5..171 6..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 119962..120061 100 N° 2 119830..119900 71 N° 3 119628..119774 147 N° 4 119437..119574 138
N° 5 119326..119385 60  
complement(join(119326..119385,119437..119574,119628..119774,119830..119900,1199 62..120061))


exon

Literature and cross-references PplPrxII01-1A (PplPrxII01a)
DNA ref. JGI genome:   scaffold_52 (120061..119326)
mRNA ref. JGI transcript:   116217
EST ref. GenBank:   FL611864.1
Protein sequence: PplPrxII01-1A (PplPrxII01a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18142.38  
PI (pH):   %s   5.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPTVKVGDAVPEGTFSYIAYAPELDDHTACGIPTTLSTSEWKGKKVVLFSVPGAFPTCHVNHLPPYLEKYEEFKKKGVDVVAVVAANDAFVMSGWARVFGLKDKIVALSDTDAKWSKSLGLDKDLSAIGFGTRTDRYALVLDDLKIKYIGLEPGADVTVSGADAVLAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 10 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCCACTGTCAAGGTTGGCGACGCCGTCCCCGAGGGCACCTTTTCCTACATTGCCTACGCCCCAGAGCTCGACGATCACACCGCCTGTGGTATCCGTGAGTAGTCTATCCCACCG
ATTGTCCCGATCTGCTCGATAACATGGCGGTCCGTGTACAGCCACCACGCTCTCCACGAGTGAATGGAAGGGAAAGAAGGTTGTCCTTTTCTCCGTTCCCGGAGCCTTCACGGTTGGCAT
ATTGTCTCTCACGCGCGGTGCCCGTAATACTGACCGGTCGTTGCTAGCCTACCTGCCACGTAAACCACCTGCCGCCATACCTCGAGAAGTACGAGGAGTTCAAGAAGAAGGGCGTTGATG
TCGTCGCTGTTGTCGCCGCGAACGACGCCTTCGTCATGAGCGGCTGGGCGCGCGTTTTCGGATTGAAGGACAAG
GTGAAGAGCATTGTGCCCATTTTTGTACGATCTGCTGATCTCTGGC
TAAACAGATCGTCGCGCTCTCTGATACCGACGCGAAGTGGTCCAAGTCGCTCGGTCTTGACAAAGATCTCTCGGCCATTGGCTTCGGTACCCGCACCGACCGCTATGCCTTGGTCTTGGA
CGACCTTAAGATCAAGTACATTGGG
GTGCGTTTTCCCTCTTTGTTAAATACGCAAGATCACTGACTTTCTGTGCAGCTCGAGCCAGGAGCAGATGTTACGGTCTCCGGTGCAGATGCTGT
CTTGGCCGCTCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCCACTGTCAAGGTTGGCGACGCCGTCCCCGAGGGCACCTTTTCCTACATTGCCTACGCCCCAGAGCTCGACGATCACACCGCCTGTGGTATCCCCACCACGCTCTCCACGAGT
GAATGGAAGGGAAAGAAGGTTGTCCTTTTCTCCGTTCCCGGAGCCTTCACG
CCTACCTGCCACGTAAACCACCTGCCGCCATACCTCGAGAAGTACGAGGAGTTCAAGAAGAAGGGCGTT
GATGTCGTCGCTGTTGTCGCCGCGAACGACGCCTTCGTCATGAGCGGCTGGGCGCGCGTTTTCGGATTGAAGGACAAG
ATCGTCGCGCTCTCTGATACCGACGCGAAGTGGTCCAAGTCG
CTCGGTCTTGACAAAGATCTCTCGGCCATTGGCTTCGGTACCCGCACCGACCGCTATGCCTTGGTCTTGGACGACCTTAAGATCAAGTACATTGGG
CTCGAGCCAGGAGCAGATGTTACG
GTCTCCGGTGCAGATGCTGTCTTGGCCGCTCTCTGA

Retrieve as FASTA