Entry information : PplCcP01-1A (PplCcP01a)
Entry ID 6741
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Christophe Dunand)
Peroxidase information: PplCcP01-1A (PplCcP01a)
Name (synonym) PplCcP01-1A (PplCcP01a)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplCcP01-1A
start..stop
S start..stop
WcoCcP 626 0 1..373 1..372
TcamCcP 617 0 1..373 1..372
LsulCcP01 603 0 1..373 1..373
FpinCcP 598 0 1..371 1..375
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 230454..230750 297 N° 2 230808..230862 55 N° 3 230922..231003 82 N° 4 231061..231331 271
N° 5 231402..231418 17 N° 6 231472..231771 300 N° 7 231830..231929 100  
join(230454..230750,230808..230862,230922..231003,231061..231331,231402..231418, 231472..231771,231830..231929)


exon

Literature and cross-references PplCcP01-1A (PplCcP01a)
DNA ref. JGI genome:   scaffold_75 (230454..231929)
EST ref. GenBank:   FL623320.1 [5' end]   FL623319.1 [3' end]
Cluster/Prediction ref. JGI gene:   116475
Protein sequence: PplCcP01-1A (PplCcP01a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   41124.45 Transmb domain:   %s   i42-64o
PI (pH):   %s   8.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFAAFRASLRKAPFSPPRAARVVRTPSGAFRRYSTEVPKKSNTALFAGLGAAAVGGIAIYVYASDSNSAKEAGTAVKSGVQVAKSAAHFTPTKDDYQKVYNKIADIMEEAADKNYDDGSYGPVLVRLAWHASGTYDKETGTGGSNYATMRFEPEALHGANNGLHVARGIMEGIHEQFPWISYGDLWTLGGVCAIQEMGGPKIPWRPGRIDGFAPQATPDGRLPDGAQGAQHLRVFYRMGFNDQEIVALSGAHALGRCHRDRSGFEGPWTFSPVTVSNEYYRLLLEEKWVWRKWDGPKQLQDKTTRSLMMLPSDYALTQDKAFRKWVEAYAKDQDVWFKDFSNVISHLFELGVPEAQFVASEGWIMKGTDEQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCGCAGCCTTCAGGGCTTCTCTCCGCAAGGCCCCCTTCTCGCCTCCAAGGGCTGCCCGCGTCGTTCGCACTCCCTCCGGAGCCTTCAGAAGATATTCCACAGAGGTGCCGAAG
AAGTCGAACACCGCTCTCTTCGCTGGTCTGGGAGCAGCCGCCGTCGGCGGTATTGCGATCTATGTATACGCCTCAGACTCCAACTCCGCAAAGGAGGCCGGCACTGCGGTTAAATCTGGC
GTGCAGGTCGCCAAGTCCGCCGCCCACTTCACCCCGACCAAGGATGACTACCAAAAG
GTACGTGCGTCATTGGCTCGGAGCCGCCGTGCACATGCTGATCGCCGAGCTGTGCAGGTTTAC
AACAAGATCGCGGACATCATGGAGGAGGCAGCTGACAAGAATTACGACG
GTGCGTGTGAACGACCTGCTATTGAGTTCGTTCGCTCACTTCGCCATTCAATCCGCCAGATGGCTCGTATG
GTCCCGTGCTCGTTCGCTTAGCATGGCACGCGTCCGGCACATATGACAAGGAAACTGGCACCGGCGGAAG
GTATGTCGCGACATCACCCCAACTCTGTCCCATTCGCTGAGTCAGTTCGC
GACCCAGCAACTATGCGACGATGCGCTTCGAGCCCGAAGCGCTGCACGGCGCGAACAACGGCCTGCATGTTGCGCGTGGTATCATGGAAGGCATTCACGAGCAGTTCCCCTGGATCTCGT
ACGGCGACCTTTGGACCCTCGGCGGCGTTTGCGCAATCCAGGAGATGGGCGGCCCCAAGATCCCCTGGAGGCCTGGGCGTATTGACGGTTTCGCTCCGCAGGCTACCCCTGATGGTCGTC
TTCCCGATGGTGCACAGGGCGCTCAGCACCTGAGGAAC
GTGAGTATTTCCGGCACCTGTGACGGTGAGATGCGCGGGCATGTTCTGACGTGAATTCATTGCACTCCAGGTTTTCTACCGC
ATGGG
GTACGCGGCTCCTCTCACTCAATTGTCGTGCGCGTCTAACTCTATTCCTGAAGGTTCAATGACCAGGAGATCGTCGCACTGTCTGGCGCGCACGCGCTTGGGCGGTGCCATCGTG
ACCGCTCCGGCTTCGAGGGTCCGTGGACGTTCTCCCCCGTGACAGTCAGCAACGAGTATTACCGCCTCCTGCTCGAGGAAAAGTGGGTCTGGCGCAAGTGGGACGGGCCGAAGCAACTCC
AGGACAAGACGACGCGCTCGCTCATGATGCTCCCGTCGGACTACGCGCTCACCCAGGACAAGGCGTTCCGCAAGTGGGTCGAGGCGTACGCCAAGGACCAGGACGTGTGGTTCAAGGA
GT
GCGTTGACCCTCGTCTCTTTTGGTCCTTCTGCTGACCGATGCGTGCGCCGTAATAGCTTCTCTAACGTGATTTCTCACCTGTTCGAGCTTGGCGTTCCCGAGGCGCAGTTCGTTGCCTCG
GAAGGGTGGATTATGAAGGGCACTGACGAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCGCAGCCTTCAGGGCTTCTCTCCGCAAGGCCCCCTTCTCGCCTCCAAGGGCTGCCCGCGTCGTTCGCACTCCCTCCGGAGCCTTCAGAAGATATTCCACAGAGGTGCCGAAG
AAGTCGAACACCGCTCTCTTCGCTGGTCTGGGAGCAGCCGCCGTCGGCGGTATTGCGATCTATGTATACGCCTCAGACTCCAACTCCGCAAAGGAGGCCGGCACTGCGGTTAAATCTGGC
GTGCAGGTCGCCAAGTCCGCCGCCCACTTCACCCCGACCAAGGATGACTACCAAAAG
GTTTACAACAAGATCGCGGACATCATGGAGGAGGCAGCTGACAAGAATTACGACGATGGCTCG
TATGGTCCCGTGCTCGTTCGCTTAGCATGGCACGCGTCCGGCACATATGACAAGGAAACTGGCACCGGCGGAAG
CAACTATGCGACGATGCGCTTCGAGCCCGAAGCGCTGCACGGCGCG
AACAACGGCCTGCATGTTGCGCGTGGTATCATGGAAGGCATTCACGAGCAGTTCCCCTGGATCTCGTACGGCGACCTTTGGACCCTCGGCGGCGTTTGCGCAATCCAGGAGATGGGCGGC
CCCAAGATCCCCTGGAGGCCTGGGCGTATTGACGGTTTCGCTCCGCAGGCTACCCCTGATGGTCGTCTTCCCGATGGTGCACAGGGCGCTCAGCACCTGAGGAAC
GTTTTCTACCGCATG
GG
GTTCAATGACCAGGAGATCGTCGCACTGTCTGGCGCGCACGCGCTTGGGCGGTGCCATCGTGACCGCTCCGGCTTCGAGGGTCCGTGGACGTTCTCCCCCGTGACAGTCAGCAACGAG
TATTACCGCCTCCTGCTCGAGGAAAAGTGGGTCTGGCGCAAGTGGGACGGGCCGAAGCAACTCCAGGACAAGACGACGCGCTCGCTCATGATGCTCCCGTCGGACTACGCGCTCACCCAG
GACAAGGCGTTCCGCAAGTGGGTCGAGGCGTACGCCAAGGACCAGGACGTGTGGTTCAAGGA
CTTCTCTAACGTGATTTCTCACCTGTTCGAGCTTGGCGTTCCCGAGGCGCAGTTCGTT
GCCTCGGAAGGGTGGATTATGAAGGGCACTGACGAGCAGTAG

Retrieve as FASTA