Entry information : Ppl1CysPrx01-1A (Ppl1CysPrx01a)
Entry ID 6742
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2012-04-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Christophe Dunand)
Peroxidase information: Ppl1CysPrx01-1A (Ppl1CysPrx01a)
Name (synonym) Ppl1CysPrx01-1A (Ppl1CysPrx01a)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ppl1CysPrx01-1A
start..stop
S start..stop
Ppl1CysPrx01-1B 460 5e-168 1..224 1..224
Tcam1CysPrx 422 6e-153 1..223 1..223
Amus1CysPrx 391 1e-140 1..224 1..222
Lbi1CysPrx 386 9e-139 1..224 1..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 251801..251896 96 N° 2 251662..251732 71 N° 3 251455..251593 139 N° 4 251303..251395 93
N° 5 251150..251244 95 N° 6 251087..251097 11 N° 7 250904..251034 131 N° 8 250809..250847 39
complement(join(250809..250847,250904..251034,251087..251097,251150..251244,2513 03..251395,251455..251593,251662..251732,251801..251896))


exon

Literature and cross-references Ppl1CysPrx01-1A (Ppl1CysPrx01a)
DNA ref. GenBank:   ABWF01001976.1 (26996..25909) JGI genome:   scaffold_30 (250809..251896)
EST ref. GenBank:   FL632213.1
Cluster/Prediction ref. JGI gene:   108287 [Incorrect splicing]
Protein sequence: Ppl1CysPrx01-1A (Ppl1CysPrx01a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   25199.07  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPNLRLGYIAPDFEAETTQGPIKFHEWIGDSWAILFSHPGDFTPVCTTELAEVSRKAPEWAKRNVKVIGLSANDLKDHQKWVEDINDFGTKNLGPTNVQFPIADADRKISTLYDMLDEQDATNRDAKGLPFTIRTVFVIDPKKVIRLTLAYPASTGRNFDEILRVVSLQLGDKHRVTTPVNWKKGDDVIVHPSVSNEEAKTLFPDVTFHKQSYLRTTPLKVE

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns) and 32 ESTs. Incorrect prediction from JGI (fusion of two ORF).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAACCTTCGTCTTGGTTACATCGCCCCCGATTTCGAGGCAGAGACCACTCAGGGTCCTATCAAATTCCATGAGTGGATCGGTGATTCATGGGTGCGGCGCCGCTGCCCTTGTCGT
CTATTGCGGATGGCGCGTTAACAGACATGTTGTGAACGCTTCAGGCCATTCTGTTCTCGCATCCCGGAGATTTCACACCTGTCTGCACCACCGAGCTTGCCGAGGTGTCGAGGAAGTAAG
TTTGCATTCCTGGCGGGATGCTCCCGCGTCTAGACTGACTGGCCCCTCCTCCTCATCCGCTAGAGCGCCTGAGTGGGCGAAACGCAACGTGAAGGTTATCGGTCTCTCTGCGAATGACCT
GAAGGACCACCAGAAATGGGTTGAGGACATCAACGACTTCGGCACGAAGAACCTCGGCCCCACAAACGTCCAGTTCCCGATT
GTGAGTGGCCCCGCGGGCCCACCCGTGTCGCCTCACAT
CAATAACGCAGTTTACAACAGATTGCCGACGCGGACAGAAAGATCTCGACGCTGTATGACATGCTCGATGAGCAGGATGCGACGAACCGGGACGCGAAGGGCCTGCCGTTCACCGTACGT
CGGTCCCGCCCACCCCACGGACACATGCACCTCACGCTTGTGGTTTCGACAGATCCGTACAGTGTTCGTGATTGATCCTAAGAAGGTTATCCGCTTGACACTCGCCTACCCTGCGTCGAC
TGGACGCAACTTTGACGAGATTCTGCG
GTAGGTTTGATATTGTGATCCCGATAACCACGAGCTCACCTGTGCCTTGCAGAGTTGTGGATTGTAAGAAGCCCCGAACTCGTCGGCCATGTT
GCTTATTGACGTGATTGAACAGCGCTCCAACTCGGCGACAAGCACCGCGTCACAACCCCCGTCAACTGGAAGAAGGGCGACGATGTTATCGTCCATCCGTCTGTGTCCAATGAGGAGGCT
AAAACGCTGTTCCCTGATGTAACTTTCCACAAG
GTGAGTTTGTTCGTACTGGGGCATTCGATGCGAAAGCGCTGACTTTGATCTCACAGCAATCGTACCTCAGGACGACTCCCCTCAAGG
TTGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAACCTTCGTCTTGGTTACATCGCCCCCGATTTCGAGGCAGAGACCACTCAGGGTCCTATCAAATTCCATGAGTGGATCGGTGATTCATGGGCCATTCTGTTCTCGCATCCCGGA
GATTTCACACCTGTCTGCACCACCGAGCTTGCCGAGGTGTCGAGGAA
AGCGCCTGAGTGGGCGAAACGCAACGTGAAGGTTATCGGTCTCTCTGCGAATGACCTGAAGGACCACCAGAAA
TGGGTTGAGGACATCAACGACTTCGGCACGAAGAACCTCGGCCCCACAAACGTCCAGTTCCCGATT
ATTGCCGACGCGGACAGAAAGATCTCGACGCTGTATGACATGCTCGATGAGCAG
GATGCGACGAACCGGGACGCGAAGGGCCTGCCGTTCACC
ATCCGTACAGTGTTCGTGATTGATCCTAAGAAGGTTATCCGCTTGACACTCGCCTACCCTGCGTCGACTGGACGCAACTTT
GACGAGATTCTGCG
AGTTGTGGATTCGCTCCAACTCGGCGACAAGCACCGCGTCACAACCCCCGTCAACTGGAAGAAGGGCGACGATGTTATCGTCCATCCGTCTGTGTCCAATGAGGAG
GCTAAAACGCTGTTCCCTGATGTAACTTTCCACAAG
CAATCGTACCTCAGGACGACTCCCCTCAAGGTTGAGTGA

Retrieve as FASTA