Entry information : Pc1CysPrx01
Entry ID 6743
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: Pc1CysPrx01
Name Pc1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pc1CysPrx01
start..stop
S start..stop
Pcar1CysPrx01 406 1e-146 1..222 1..222
Athi1CysPrx01 404 7e-146 1..222 1..222
Hcy1CysPrx 400 3e-144 1..222 1..222
Amus1CysPrx 396 1e-142 1..222 1..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 959426..959521 96 N° 2 959299..959369 71 N° 3 959113..959248 136 N° 4 958968..959060 93
N° 5 958804..958909 106 N° 6 958617..958747 131 N° 7 958523..958558 36  
complement(join(958523..958558,958617..958747,958804..958909,958968..959060,9591 13..959248,959299..959369,959426..959521))


exon

Literature and cross-references Pc1CysPrx01
DNA ref. JGI genome:   scaffold_2 (959521..958523)
mRNA ref. JGI transcript:   10009
Protein sequence: Pc1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222
PWM (Da):   %s   24917.98  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGNIAPDFEAETTKGPIKFHEWIGDSWAVLFSHPGDFTPVCTTELAEVARRAPDFAKRGVKVIGISANGLDDHHKWTKDIEEWGAKFAPTTVDFPIADADRKISTLYDMLDEQDATNRDAKGLPFTIRTVFIIDPKKVIRLMIAYPASTGRNFDEIIRVIDSLQIGDKYRVTTPVNWKKGEDVIVHPTVSNEEAKTLFPEFTIHPYLRTTPLKVD*

Retrieve as FASTA  
Remarks Complete sequence form genomic (6 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTTCGTCTTGGTAACATCGCTCCCGACTTTGAGGCCGAGACCACCAAGGGTCCTATCAAGTTCCACGAGTGGATCGGCGACTCATGGGTACGCAGTACACCGTGTAGTGTC
GCATGTTATCACTGAATGCGGGGTAATCGCAGGCTGTCCTGTTCTCCCACCCCGGAGACTTCACTCCTGTTTGCACCACGGAGCTCGCTGAAGTCGCTCGCCGGTATGTTCTCAGGAACG
TCGATGCTGCATGAGATGCTGAAGAGCCCCTAGTGCGCCCGACTTTGCCAAGCGCGGTGTGAAGGTCATCGGTATCTCCGCCAACGGGCTCGATGACCACCACAAGTGGACGAAGGATAT
TGAGGAATGGGGCGCGAAGTTCGCGCCGACCACTGTCGACTTCCCTATC
GTACGTCCTTGCTAGAACTAGCCGTAGAATTGCGAGCTGAGGACTTGAACAGATCGCGGACGCGGACCGCA
AGATCTCCACGCTCTACGACATGCTCGACGAGCAGGATGCCACCAACCGTGACGCTAAGGGCCTTCCTTTCACC
GTGCGTCTCCTTCCTCATCTTTATGACTCATAACCTAAATTCTAGT
CCTTGCACCCAGATACGTACTGTGTTCATTATCGACCCTAAGAAGGTCATCCGTTTGATGATTGCCTACCCTGCTTCGACCGGTCGTAACTTCGACGAGATCATTCGTGTCATCGATTGT
ATGTGCACACCATGCGATACTACTCAAGTCGAATATGTATTGACACTGCTGCAGCCCTCCAAATCGGCGATAAGTACCGCGTTACGACGCCTGTTAACTGGAAGAAGGGTGAGGATGTCA
TCGTTCACCCGACTGTCAGCAACGAAGAGGCCAAAACACTCTTCCCGGAGTTCACGATTCACAAG
GTTTGCTTGTTCTCTTTCCATCGTAAAGCGTTCGGTACTCATGCACATGATATTG
CAGCCTTACCTCAGGACCACCCCTCTTAAGGTTGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTTCGTCTTGGTAACATCGCTCCCGACTTTGAGGCCGAGACCACCAAGGGTCCTATCAAGTTCCACGAGTGGATCGGCGACTCATGGGCTGTCCTGTTCTCCCACCCCGGA
GACTTCACTCCTGTTTGCACCACGGAGCTCGCTGAAGTCGCTCGCCG
TGCGCCCGACTTTGCCAAGCGCGGTGTGAAGGTCATCGGTATCTCCGCCAACGGGCTCGATGACCACCACAAG
TGGACGAAGGATATTGAGGAATGGGGCGCGAAGTTCGCGCCGACCACTGTCGACTTCCCTATC
ATCGCGGACGCGGACCGCAAGATCTCCACGCTCTACGACATGCTCGACGAGCAGGAT
GCCACCAACCGTGACGCTAAGGGCCTTCCTTTCACC
ATACGTACTGTGTTCATTATCGACCCTAAGAAGGTCATCCGTTTGATGATTGCCTACCCTGCTTCGACCGGTCGTAACTTCGAC
GAGATCATTCGTGTCATCGATT
CCCTCCAAATCGGCGATAAGTACCGCGTTACGACGCCTGTTAACTGGAAGAAGGGTGAGGATGTCATCGTTCACCCGACTGTCAGCAACGAAGAGGCC
AAAACACTCTTCCCGGAGTTCACGATTCACAAG
CCTTACCTCAGGACCACCCCTCTTAAGGTTGACTAA

Retrieve as FASTA