Entry information : Pc1CysPrx02
Entry ID 6744
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2012-03-28 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: Pc1CysPrx02
Name Pc1CysPrx02
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pc1CysPrx02
start..stop
S start..stop
Pcar1CysPrx02 396 1e-142 6..226 4..224
Athi1CysPrx01 306 4e-107 8..223 4..219
Pc1CysPrx01 303 5e-106 7..223 3..219
Lbi1CysPrx 300 2e-104 7..223 3..219
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1272508..1272615 108 N° 2 1272676..1272746 71 N° 3 1272806..1272941 136 N° 4 1272993..1273085 93
N° 5 1273140..1273234 95 N° 6 1273287..1273297 11 N° 7 1273359..1273489 131 N° 8 1273538..1273573 36
join(1272508..1272615,1272676..1272746,1272806..1272941,1272993..1273085,1273140 ..1273234,1273287..1273297,1273359..1273489,1273538..1273573)


exon

Literature and cross-references Pc1CysPrx02
DNA ref. JGI genome:   scaffold_7 (1272508..1273573)
mRNA ref. JGI transcript:   126313
Protein sequence: Pc1CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   25664.66  
PI (pH):   %s   4.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSGTTLRLGSIVPDFEADTTEGPIRFHEWIGDSWVMFFSHPGDFTPVCTTELADISHRAPQFVQRNIKVIGISADALQEHYEWIDDIIEIGNKTAPTCVEYPIADPDRKIARMYEMLDEQDETNVSEDGEMNTIRTVFFIDPKKTIRAMINYPASVGRDFDEIIRVFSLQATDRYPISTPVNWQKGDDVIIQPHISDEEAAKRFPGYKSFKPYLRTTPFPPT

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). No ESTs. Uncorrect prediction from JGI (exon 5 is not predicted)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCTCGGGTACAACACTTCGTCTCGGCAGCATTGTCCCAGACTTTGAGGCAGACACCACCGAGGGGCCCATCCGGTTCCACGAATGGATTGGTGACTCTTGGGTGCGCACACTG
CGGTACGGGATGCACAGAGCAGCTCTCTGACATTTTAACATACAACAGGTAATGTTCTTCTCGCATCCTGGCGACTTCACGCCTGTATGCACGACAGAGCTTGCGGATATTTCACACCGG
TGCGTCTGACCGGTCGCTGGTCTGCCCGACCTGCCCTGACGATCCTTGCCGTGTTCAGAGCCCCGCAATTCGTTCAGCGCAACATCAAGGTTATTGGCATTTCGGCCGACGCGCTGCAGG
AGCACTACGAGTGGATAGACGACATCATTGAGATAGGGAACAAGACCGCACCGACATGCGTCGAGTATCCCATC
GTGCGTCGTCCTGCCCCTGACGCTACCAGGTTGTTAACACTCCCGA
TATAGATAGCCGACCCCGACAGGAAGATTGCGCGCATGTACGAGATGCTTGACGAGCAGGACGAGACTAATGTCAGTGAGGATGGCGAGATGAACACTGTAAGCTCGGATGCGACCTCAC
GGCTGGCCTCTCCTCCTTCATTCCCCATACAGATCCGCACCGTCTTCTTCATCGACCCGAAGAAAACCATCCGCGCCATGATAAACTACCCTGCGTCCGTCGGTCGTGACTTTGACGAAA
TTATCAG
GTGCGTCGTACGACTCCATTCCATGACTGGTTATAGCTGACTCGAACTCCAGAGTATTTGACTGTAAGCACGGAGGTGTATAGACCCTGTAGCCTGGACTAACGAATTTCAAC
AACCTTATTAGCCCTTCAAGCCACCGACAGGTACCCTATCAGTACGCCTGTCAACTGGCAGAAGGGCGACGACGTCATTATACAACCGCACATATCGGACGAAGAAGCTGCGAAGCGTTT
CCCTGGATATAAATCCTTCAAG
GTACGGATTGCGCAGACCCAGTCCTGCAGGACACTGAACAGCTGCTAGCCATACCTACGCACCACGCCATTCCCGCCGACATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCTCGGGTACAACACTTCGTCTCGGCAGCATTGTCCCAGACTTTGAGGCAGACACCACCGAGGGGCCCATCCGGTTCCACGAATGGATTGGTGACTCTTGGGTAATGTTCTTC
TCGCATCCTGGCGACTTCACGCCTGTATGCACGACAGAGCTTGCGGATATTTCACACCG
AGCCCCGCAATTCGTTCAGCGCAACATCAAGGTTATTGGCATTTCGGCCGACGCGCTGCAG
GAGCACTACGAGTGGATAGACGACATCATTGAGATAGGGAACAAGACCGCACCGACATGCGTCGAGTATCCCATC
ATAGCCGACCCCGACAGGAAGATTGCGCGCATGTACGAGATGCTT
GACGAGCAGGACGAGACTAATGTCAGTGAGGATGGCGAGATGAACACT
ATCCGCACCGTCTTCTTCATCGACCCGAAGAAAACCATCCGCGCCATGATAAACTACCCTGCGTCCGTCGGT
CGTGACTTTGACGAAATTATCAG
AGTATTTGACTCCCTTCAAGCCACCGACAGGTACCCTATCAGTACGCCTGTCAACTGGCAGAAGGGCGACGACGTCATTATACAACCGCACATATCG
GACGAAGAAGCTGCGAAGCGTTTCCCTGGATATAAATCCTTCAAG
CCATACCTACGCACCACGCCATTCCCGCCGACATAG

Retrieve as FASTA