Entry information : PcPrxII
Entry ID 6745
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcPrxII
Name PcPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcPrxII
start..stop
S start..stop
PcarPrxII 290 2e-102 12..173 1..162
SlutPrxII01 219 3e-74 2..173 4..172
AthiPrxII 218 6e-74 4..173 6..172
SbrePrxII01 217 2e-73 2..173 4..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1028676..1028772 97 N° 2 1028829..1028899 71 N° 3 1028959..1029105 147 N° 4 1029159..1029302 144
N° 5 1029358..1029420 63  
join(1028676..1028772,1028829..1028899,1028959..1029105,1029159..1029302,1029358 ..1029420)


exon

Literature and cross-references PcPrxII
DNA ref. JGI genome:   scaffold_10 (1028676..1029420)
mRNA ref. JGI transcript:   125657
EST ref. GenBank:   DV757768.1
Protein sequence: PcPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   18276.5  
PI (pH):   %s   5.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVNVKVGDTVPTGKFVTVYYTPELESHSACGAPSKLTTDAFKGKKVVIFAVPGAFPSCHANHLPPYAEKYAELKAKGVDDVYVLSANDPFVLSGWTRVQGVADKITGLTDIDAEWSKQLGLTVDLSGLGIGLGQRTTRYALVLDDLKVKYLGVEEDPTQVTVSGVDAVLAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAACGTCAAGGTCGGCGACACCGTCCCCACTGGCAAGTTCGTCACCGTGTACTACACGCCCGAGCTCGAGTCGCACTCCGCATGCGGCGCCCGTACGTCTCTCCCTCAAGCAGCG
GAAGCACGACATACTCACTCCGTCTCTGTGCAGCCTCCAAGCTGACGACGGACGCCTTCAAGGGCAAGAAGGTCGTCATCTTCGCCGTGCCCGGAGCGTTCACGGTGCGCACATGCACAC
GAAAAGCGTTACCCGCGCGCCTACTGACCCCGCGACGCTGCAGCCTTCCTGCCACGCGAACCACCTGCCACCGTACGCCGAAAAGTACGCCGAGCTGAAGGCGAAGGGCGTCGACGACGT
GTATGTGCTCTCGGCCAACGACCCCTTCGTGCTCAGCGGCTGGACCCGCGTCCAGGGCGTCGCCGACAAG
GTGCGTGGCTTGCGCTGCTGAGCAAATGCCGCAGAGTTGACTCCTCGGTG
CAGATCACCGGTCTCACCGACATCGATGCCGAGTGGTCGAAGCAGTTGGGCCTGACCGTGGACCTCAGCGGCCTCGGAATCGGCCTCGGACAGCGCACCACCCGCTACGCGCTTGTGCTC
GATGACCTCAAGGTCAAGTACCTTGGA
GTACGTGGCGCCGTTTCGTTTCCATGTTTCGTATTCTCACACTCTTGATGGGCAGGTTGAGGAGGACCCGACCCAAGTTACTGTCTCCGGCGT
CGACGCTGTTCTCGCTGCTCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAACGTCAAGGTCGGCGACACCGTCCCCACTGGCAAGTTCGTCACCGTGTACTACACGCCCGAGCTCGAGTCGCACTCCGCATGCGGCGCCCCCTCCAAGCTGACGACGGACGCC
TTCAAGGGCAAGAAGGTCGTCATCTTCGCCGTGCCCGGAGCGTTCACG
CCTTCCTGCCACGCGAACCACCTGCCACCGTACGCCGAAAAGTACGCCGAGCTGAAGGCGAAGGGCGTCGAC
GACGTGTATGTGCTCTCGGCCAACGACCCCTTCGTGCTCAGCGGCTGGACCCGCGTCCAGGGCGTCGCCGACAAG
ATCACCGGTCTCACCGACATCGATGCCGAGTGGTCGAAGCAGTTG
GGCCTGACCGTGGACCTCAGCGGCCTCGGAATCGGCCTCGGACAGCGCACCACCCGCTACGCGCTTGTGCTCGATGACCTCAAGGTCAAGTACCTTGGA
GTTGAGGAGGACCCGACCCAA
GTTACTGTCTCCGGCGTCGACGCTGTTCTCGCTGCTCTCTAA

Retrieve as FASTA