Entry information : PplPrxQ02
Entry ID 6747
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Catherine Mathe (Scipio))
Peroxidase information: PplPrxQ02
Name PplPrxQ02
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplPrxQ02
start..stop
S start..stop
LbiPrxQ02 300 1e-104 1..227 1..226
CcinPrxQ 266 5e-91 1..228 1..230
PcarPrxQ02 265 1e-90 15..214 4..214
HanPrxQ02 263 4e-89 42..228 90..274
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 201714..201881 168 N° 2 201531..201585 55 N° 3 201337..201480 144 N° 4 201147..201268 122
N° 5 200934..201088 155 N° 6 200823..200874 52  
complement(join(200823..200874,200934..201088,201147..201268,201337..201480,2015 31..201585,201714..201881))


exon

Literature and cross-references PplPrxQ02
DNA ref. JGI genome:   scaffold_95 (201881..200823)
mRNA ref. JGI transcript:   116341
EST ref. GenBank:   FL597077.1
Protein sequence: PplPrxQ02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   231
PWM (Da):   %s   24569.77  
PI (pH):   %s   9.1
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTGRTKATAEPTEPTRRSSRISAQPKAEVKEPVQKATAKSKKRTADVDGDSPAVKKSKAEEEAAEAPDTAESNAAVAKLATIDVGDALPSLTLQNEKGEDVEVSTLAAEKGVILFLVPKADTPGCTTQACGFRDIYPDFTAHNFDVYCLSADSASAQTKWQTKNLPYPLLSDPKRQLISALGAGEGGKTKRSHFVFEKGGKLVEKRLPVKPADSPRLALEYVKNLNSASA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 7 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGGCCGTACCAAAGCAACTGCTGAGCCTACTGAGCCTACCAGGCGGTCTTCTCGCATTTCTGCACAACCGAAAGCAGAAGTGAAGGAACCCGTTCAAAAGGCTACTGCAAAATCC
AAGAAGAGAACAGCTGATGTGGATGGAGACAGTCCTGCTGTAAAAAAG
GTACGCGTTAGCGGCTTGGCGAAGGTTCTGGAGACGTTCTGTATTTTGCACAGTCGCTATGAAGTGTTATTG
TATCGTTGTGTTCTCAAGACTGACCAGGGTGACTGCTTATCCGTTCTGCTCTGCAGAGCAAGGCCGAGGAGGAGGCTGCCGAGGCACCTGATACTGCGGAATCCAATGCGGGTATGTCCA
TAGAATGATGAGGAAGCGTGCACTCTTGATACATTTTATAGCTGTTGCCAAGTTGGCGACGATCGATGTCGGAGATGCTCTGCCTTCTCTGACGCTCCAGAACGAGAAGGGGGAGGACGT
AGAGGTGTCGACACTGGCAGCGGAGAAAGGGGTGATCCTGTTCCTTGTGCCCAAGGCTGATACAC
GTGAGTTCAACTGATTATACATGATTACTTCCAATTTAACTCGTTGTTGAATTCG
AAATGTGTTTCAGCCGGCTGTACCACCCAAGCTTGCGGCTTCCGCGATATATACCCCGACTTCACTGCCCACAACTTTGATGTCTACTGTTTGAGTGCGGATAGTGCGTCTGCTCAGACC
AAGTGGCAAACAAAG
GTTCGCATGGCGTCAGTTGTGTTGCAGTTCTTTGATGCATGGTTCATCTGATCGGTAGAAAAACCTGCCCTATCCCTTGCTCTCGGACCCTAAGCGCCAGTTGAT
CAGCGCCCTAGGTGCTGGGGAGGGTGGAAAGACCAAGCGTAGCCACTTCGTCTTCGAGAAGGGCGGGAAACTCGTCGAGAAAAGGCTTCCCGTGAAACCTGCTGACAG
GTATGTAAATCA
TTTGGTGGAATCTTTGCGTGAGTAACGACATGACACGCGATGCATAGCCCGAGACTCGCTCTTGAGTACGTGAAGAATCTCAATTCTGCTTCTGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGGCCGTACCAAAGCAACTGCTGAGCCTACTGAGCCTACCAGGCGGTCTTCTCGCATTTCTGCACAACCGAAAGCAGAAGTGAAGGAACCCGTTCAAAAGGCTACTGCAAAATCC
AAGAAGAGAACAGCTGATGTGGATGGAGACAGTCCTGCTGTAAAAAAG
AGCAAGGCCGAGGAGGAGGCTGCCGAGGCACCTGATACTGCGGAATCCAATGCGGCTGTTGCCAAGTTGGCG
ACGATCGATGTCGGAGATGCTCTGCCTTCTCTGACGCTCCAGAACGAGAAGGGGGAGGACGTAGAGGTGTCGACACTGGCAGCGGAGAAAGGGGTGATCCTGTTCCTTGTGCCCAAGGCT
GATACAC
CCGGCTGTACCACCCAAGCTTGCGGCTTCCGCGATATATACCCCGACTTCACTGCCCACAACTTTGATGTCTACTGTTTGAGTGCGGATAGTGCGTCTGCTCAGACCAAGTGG
CAAACAAAG
AAAAACCTGCCCTATCCCTTGCTCTCGGACCCTAAGCGCCAGTTGATCAGCGCCCTAGGTGCTGGGGAGGGTGGAAAGACCAAGCGTAGCCACTTCGTCTTCGAGAAGGGC
GGGAAACTCGTCGAGAAAAGGCTTCCCGTGAAACCTGCTGACAG
CCCGAGACTCGCTCTTGAGTACGTGAAGAATCTCAATTCTGCTTCTGCCTGA

Retrieve as FASTA