Entry information : PplPrxQ01
Entry ID 6748
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-17 (Catherine Mathe (Scipio))
Peroxidase information: PplPrxQ01
Name PplPrxQ01
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplPrxQ01
start..stop
S start..stop
PcPrxQ 250 2e-85 3..164 5..166
PcarPrxQ01 243 2e-82 3..164 5..166
PinvPrxQ02 223 6e-75 2..156 3..161
HcyPrxQ 221 2e-74 1..172 1..177
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1304086..1304212 127 N° 2 1304280..1304330 51 N° 3 1304404..1304501 98 N° 4 1304562..1304680 119
N° 5 1304756..1304945 190  
join(1304086..1304212,1304280..1304330,1304404..1304501,1304562..1304680,1304756 ..1304945)


exon

Literature and cross-references PplPrxQ01
DNA ref. JGI genome:   scaffold_1 (1304086..1304945)
EST ref. GenBank:   FL608185.1
Protein sequence: PplPrxQ01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194
PWM (Da):   %s   20718.53  
PI (pH):   %s   4.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPHPLVGKPAPSLSLPDANGETYTLTPVASDVPIALFFYPQSGTYGCTKEACEFRDALAEKELYQRTKVQIIGVSKDPVEKQKVFVEKEKLYPVLSDASGDARKAYHVGKGLLGLTDARVTFFIDSKGVVRDVLDTTVNFSAHAKFVTKWLDKIEAEEGKSTADESAVPAPAGAEGAEPVSPTGEGEGEQQQA

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 38 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCATCCACTCGTCGGAAAGCCCGCTCCTTCTCTTTCTCTCCCGGACGCGAATGGGGAGACTTACACCTTGACCCCTGTGGCCAGCGATGTTCCCATTGCCTTGTTCTTTTATCCT
CAGTCTG
GTATGAATGGTACTCCCTCATGACTAATTATCGCCGACTGACATCGGTGGTGTTTCGCAATCCCTAGGAACGTATGGGTGCACAAAGGAAGCCTGCGAATTCCGCGATGCTCT
TGCTG
GTATTTATCATTCCATCGGAAGTGTTCTGGTGCGAGGGTGGTCTCACACCCCTGTGGCATTTGTTCTCTCTAGAAAAGGAGTTGTATCAGCGCACCAAAGTCCAAATTATCGGGG
TCAGCAAGGACCCAGTTGAGAAACAGAAAGTCTTCGTGGAGAAGGAGAAGCTAACG
GTGGGCGTGTTTCCAGATGTTCACGCGTTATCAGATATTGACAGAGAAGCTCATCTTTAGTACC
CCGTTCTGAGCGATGCCAGTGGGGATGCACGCAAAGCGTACCACGTCGGGAAAGGCCTACTGGGTCTCACGGACGCTCGCGTCACCTTTTTTATTGACTCCAAGGGGGTTGTGCG
GTGAG
TGGTCCGAGTGTGTGTGAACAGGCATGCAGATCTGACGTTCTGGTTTCCACTTGGAAATCGTGTCAACAGGGACGTGTTGGACACGACGGTGAATTTCAGTGCTCACGCCAAGTTCGTCA
CGAAGTGGCTCGATAAGATCGAGGCAGAGGAAGGCAAATCGACTGCGGACGAGAGCGCCGTGCCCGCTCCAGCCGGTGCGGAAGGAGCAGAACCAGTATCCCCCACTGGTGAAGGTGAGG
GTGAACAGCAGCAGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCATCCACTCGTCGGAAAGCCCGCTCCTTCTCTTTCTCTCCCGGACGCGAATGGGGAGACTTACACCTTGACCCCTGTGGCCAGCGATGTTCCCATTGCCTTGTTCTTTTATCCT
CAGTCTG
GAACGTATGGGTGCACAAAGGAAGCCTGCGAATTCCGCGATGCTCTTGCTGAAAAGGAGTTGTATCAGCGCACCAAAGTCCAAATTATCGGGGTCAGCAAGGACCCAGTTGAG
AAACAGAAAGTCTTCGTGGAGAAGGAGAAGCTAACG
TACCCCGTTCTGAGCGATGCCAGTGGGGATGCACGCAAAGCGTACCACGTCGGGAAAGGCCTACTGGGTCTCACGGACGCTCGC
GTCACCTTTTTTATTGACTCCAAGGGGGTTGTGCG
GGACGTGTTGGACACGACGGTGAATTTCAGTGCTCACGCCAAGTTCGTCACGAAGTGGCTCGATAAGATCGAGGCAGAGGAAGGC
AAATCGACTGCGGACGAGAGCGCCGTGCCCGCTCCAGCCGGTGCGGAAGGAGCAGAACCAGTATCCCCCACTGGTGAAGGTGAGGGTGAACAGCAGCAGGCTTGA

Retrieve as FASTA