Entry information : PcPrxQ02
Entry ID 6749
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcPrxQ02
Name PcPrxQ02
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcPrxQ02
start..stop
S start..stop
PcarPrxQ02 390 2e-140 1..218 1..215
PplPrxQ02 257 1e-87 4..217 15..214
LbiPrxQ02 252 8e-86 5..217 16..213
AmusPrxQ 248 1e-83 2..215 16..234
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 746293..746427 135 N° 2 746510..746615 106 N° 3 746673..746807 135 N° 4 746858..746979 122
N° 5 747030..747188 159  
join(746293..746427,746510..746615,746673..746807,746858..746979,747030..747188)


exon

Literature and cross-references PcPrxQ02
DNA ref. JGI genome:   scaffold_12 (746293..747188)
mRNA ref. JGI transcript:   124208 [3' end]
EST ref. GenBank:   DV764242.1 [5' end]
Protein sequence: PcPrxQ02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   218
PWM (Da):   %s   23265.03  
PI (pH):   %s   9.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAETRRSSRIAAQPKKEEPPKPARKPTKKRSTGEAAGEEAPAAKKAKNDEKPAETQEGEQPTDASVGDAKVEGAQSQADNAVKPIDIGDSLPSITLKNEKGEDVDVSKLAAEKGVIFFLVPKADTPGCTTQACGFRDAYPNFTEAGYDVYCLSADTPNAQSKWQTKELPYPLLSDPKRVLITALGAGEGGKTKRSHFIFEKGGKLIKKEIPVKPAER*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 2 ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGACACGCCGCTCCTCGCGCATTGCAGCGCAGCCCAAGAAGGAGGAGCCTCCGAAGCCCGCGCGCAAGCCCACGAAGAAGAGGTCCACCGGCGAGGCTGCCGGAGAAGAGGCC
CCGGCTGCTAAGAAG
GTCTGTATCATGCCTTTGATGAGCAGAGCCCTCTAGATGCCACAGTTTATCCCTGAATTAATTAATGAACTGTTGTGCATAGGCTAAGAACGACGAGAAACCCGC
CGAGACCCAGGAGGGCGAACAGCCTACAGATGCAAGCGTCGGGGATGCCAAAGTAGAGGGTGCACAGTCACAGGCTGACAACG
GTGAGTTTCTACCCCGTTTTGCATTTTTGTGGTGTTT
GACTCATAATTGATATACAGCTGTGAAGCCAATTGACATTGGTGACTCCTTGCCCTCTATTACTCTCAAAAACGAGAAGGGGGAAGACGTTGATGTGTCTAAGCTCGCAGCGGAGAAGGG
TGTGATTTTCTTTTTGGTCCCCAAAGCCGATACCC
GTACGTATCTTTCCCAGCTTCGCAAGGCTATAAAGTCATATGTCGCACAGCGGGTTGCACTACCCAGGCGTGTGGCTTCCGTGAC
GCGTACCCTAACTTCACTGAGGCCGGCTATGACGTGTACTGCTTGAGCGCGGATACTCCGAATGCGCAGAGCAAATGGCAGACTAAG
GTGGGTAGCACGATATTGCTTCTGGCGTGGGGG
GCTCATATATGCGATAGAAGGAGCTTCCATACCCACTGCTTTCCGACCCGAAGCGCGTTCTTATTACGGCGCTCGGCGCGGGTGAAGGCGGAAAGACGAAGCGCAGCCACTTCATCTTTG
AGAAAGGTGGCAAGCTAATCAAGAAGGAGATTCCAGTCAAGCCTGCAGAGAGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGACACGCCGCTCCTCGCGCATTGCAGCGCAGCCCAAGAAGGAGGAGCCTCCGAAGCCCGCGCGCAAGCCCACGAAGAAGAGGTCCACCGGCGAGGCTGCCGGAGAAGAGGCC
CCGGCTGCTAAGAAG
GCTAAGAACGACGAGAAACCCGCCGAGACCCAGGAGGGCGAACAGCCTACAGATGCAAGCGTCGGGGATGCCAAAGTAGAGGGTGCACAGTCACAGGCTGACAAC
G
CTGTGAAGCCAATTGACATTGGTGACTCCTTGCCCTCTATTACTCTCAAAAACGAGAAGGGGGAAGACGTTGATGTGTCTAAGCTCGCAGCGGAGAAGGGTGTGATTTTCTTTTTGGTC
CCCAAAGCCGATACCC
CGGGTTGCACTACCCAGGCGTGTGGCTTCCGTGACGCGTACCCTAACTTCACTGAGGCCGGCTATGACGTGTACTGCTTGAGCGCGGATACTCCGAATGCGCAG
AGCAAATGGCAGACTAAG
AAGGAGCTTCCATACCCACTGCTTTCCGACCCGAAGCGCGTTCTTATTACGGCGCTCGGCGCGGGTGAAGGCGGAAAGACGAAGCGCAGCCACTTCATCTTT
GAGAAAGGTGGCAAGCTAATCAAGAAGGAGATTCCAGTCAAGCCTGCAGAGAGGTAA

Retrieve as FASTA