Entry information : PplNOx02-1A (PplNOx02a)
Entry ID 6754
Creation 2009-05-04 (Christophe Dunand)
Last sequence changes 2009-05-04 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-04-19 (Catherine Mathe)
Peroxidase information: PplNOx02-1A (PplNOx02a)
Name (synonym) PplNOx02-1A (PplNOx02a)
Class Ancestral NADPH oxidase    [Orthogroup: NOx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplNOx02-1A
start..stop
S start..stop
PplNOx02-1B 1261 0 1..609 1..609
PcarNOx02 1024 0 7..609 7..611
PcNOx02 1011 0 7..609 8..609
LbiNOx02 958 0 8..609 5..604
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 262396..262774 379 N° 2 261835..262337 503 N° 3 261557..261777 221 N° 4 261220..261492 273
N° 5 261040..261106 67 N° 6 260656..260808 153 N° 7 260378..260506 129 N° 8 260205..260298 94
N° 9 260116..260126 11  
complement(join(260116..260126,260205..260298,260378..260506,260656..260808,2610 40..261106,261220..261492,261557..261777,261835..262337,262396..262774))


exon

Literature and cross-references PplNOx02-1A (PplNOx02a)
DNA ref. JGI genome:   scaffold_76 (262774..260116)
mRNA ref. JGI transcript:   110233
EST ref. GenBank:   FL610317.1 [5' end]   FL605032.1 [3' end]   FL625089.1 [Fragment]
Protein sequence: PplNOx02-1A (PplNOx02a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   609
PWM (Da):   %s   69857.85 Transmb domain:   %s   i89-111o126-148i178-200o220-242i255-277o292-310i439-461o
PI (pH):   %s   9.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAANWTKRSSDLDFSDGKLPLAQHPDMDNPFADQGMQPSHLQRNKSERRRLQPLQRSNTVGTITSTPYKPETWVDRWRLWMINEGGKRLFFTFFVLLHVLVIVFGFLYYDTSDDLKGARKTFGITYPIARSAALVLHVEVAFILLPICRNFISLLRRTPLNSYIPFDKNITFHKAVAWGICLFTFIHIAAHMVNFARLAFADPLAKTPGERFVVWLIANFTTGPGVTGWIMTASLAIMVWYAIEKRRRANFEKFWYTHHLFIVFFLNWQLHGMFCMIQPDREPFCTWNSIGVFRYWLTGGVIFTFERILREVRSRHRTYISKVIQHPSNVMELQIKKEKTTTRAGQYIFLSCPEISYFQWHPFTLTSAPEEDYISVHIRIVGDFTRELAAAVGCDFDSKEKGVEAGGKLIGTNTNPPVNRVLPRVMVDGPFGSASEDFLNYETVLLVGAGIGVTPFASILKSIWYRMNNLNNSKPTRLSVYFTWVIRDFGSAEWFHSLLQAIEEQDTQNRIEINIYLTAKIKEDDMNNIIVQDVGAEKDAITSLRAPTHYGRPNWDRVFSSIAEKHPETDVGVFFCGPAVLSKQLHISCNKYSTPSGTKFFFGKENF

Retrieve as FASTA  
Remarks Complete sequenec from genomic (8 introns). Duplicated sequence.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTAACTGGACCAAACGCTCCTCTGACCTCGATTTCTCTGACGGCAAGTTGCCGCTCGCCCAGCACCCTGACATGGACAACCCGTTCGCGGACCAGGGCATGCAGCCCAGCCAC
CTCCAGCGCAACAAGTCGGAGCGCAGGCGCCTCCAGCCGCTTCAGCGGTCCAACACCGTCGGCACCATCACCTCCACACCCTACAAGCCCGAAACGTGGGTCGACAGATGGCGTCTGTGG
ATGATCAACGAGGGCGGGAAGCGGCTCTTCTTCACCTTCTTCGTCCTTCTCCACGTCCTCGTCATCGTCTTCGGCTTCTTGTACTACGATACGAGTGATGATCTCAAAGGCGCCCGCAAG
ACATTCGGTATTACCTACC
GTGAGTACCGTGTCGTATGTGCTACCTTACCCAGAAACGTGCTTAGTCGCGCCCCAAGCTATCGCGCGTTCCGCGGCGCTGGTCCTGCACGTCGAGGTGGC
GTTCATCCTGCTGCCCATCTGCCGCAACTTCATCTCGCTGCTCCGGCGCACGCCGCTCAACTCGTACATCCCTTTTGACAAGAACATCACCTTCCACAAGGCCGTCGCTTGGGGCATCTG
TCTCTTCACCTTCATCCACATCGCCGCGCACATGGTCAACTTTGCGCGCCTCGCGTTCGCCGACCCGCTCGCCAAGACGCCGGGCGAACGTTTCGTCGTCTGGCTCATCGCGAACTTCAC
GACGGGCCCCGGCGTTACCGGCTGGATCATGACCGCCTCCCTCGCCATCATGGTGTGGTACGCGATCGAGAAGCGCCGCCGCGCGAACTTTGAGAAGTTCTGGTACACGCATCACCTGTT
CATCGTCTTCTTCCTGAACTGGCAGCTGCACGGCATGTTCTGCATGATCCAGCCCGACCGCGAGCCGTTCTGCACGTGGAACTCCATCGGTGTCTTCTGG
GTATGTGTTGCACCGCGATG
AGCAGAGTGTTGGACACGGCTGACTGCGGGATTGCAGCGCTACTGGCTTACTGGCGGTGTGATCTTCACCTTCGAGCGTATCCTCCGTGAAGTGCGCTCCCGCCACCGGACCTACATCTC
CAAGGTCATCCAGCACCCGTCGAACGTCATGGAACTCCAGATCAAGAAGGAGAAGACGACAACGCGGGCCGGACAGTACATCTTCCTCTCCTGCCCGGAGATCTCGTACTTCCAGTGGCA
CCCCTTCACGCTCACGAG
GTACGCAGCCGCACACATACCCGCTAAATCTGATTCAAAAGTGAATTGCTCACGTATGCCGCAGCGCGCCGGAGGAAGACTACATCTCGGTGCATATCCGTA
TCGTCGGCGACTTCACGCGGGAGCTCGCGGCCGCGGTCGGCTGCGACTTCGACTCGAAGGAGAAGGGCGTGGAGGCCGGCGGGAAGCTCATCGGCACGAACACGAACCCGCCCGTGAACC
GCGTCCTGCCGCGCGTGATGGTCGACGGGCCCTTCGGCTCCGCGTCCGAGGATTTCCTCAACTACGAGACCGTCCTCCTCGTCGGTGCCGGTATCGGCGTCACGCCGTTTGCCTC
GTGCG
TCTCCCGTTCCCTTCCTCGCCGCCAGGGTGTGTGATTTGACCGTCTTCTGTCTTCTGTTTCTTGTTATCTGGTCTGTTGCACCCTGTACGCTTCGTTGGCGCGCGCAGGATCCTGAAGTC
TATCTGGTACCGCATGAACAACCTTAACAACTCGAAGCCAACGCGGCTGTCGAAG
GTGAGCAGACGCGCGCCAGGCGGTTTCTCTCCCCCGAGCTTCCATCGCAGGCCATCCGTTTTCCT
GTCCTTCTATCAATGTGTGCCCTGCATCCGTCCCTGTGTCCCTGTACCCGTGTCCAGCCGGCACGTTGTTCGGGTGGCCATCCACATCCACATCCACATGCACCTCCTCCATCTCTTTTC
ATGTATATTTTAGGCGCACGGAGGCTGACCGCGCCCGCTTGCACAGGTCTACTTCACCTGGGTCATCCGTGACTTTGGCAGCGCCGAATGGTTCCACTCGCTCCTGCAGGCCATCGAGGA
GCAGGACACGCAGAACCGCATCGAGATCAACATCTACCTCACCGCGAAGATCAAGGAGGACGACATGAACAACATCATT
GTGCGCGCTGTTCCCTATTGCCCCCTATCTGTCTCTTGCCC
CTCCGCCCCCCTCCCCTTGTTTTTTTTTCACCCTCTTCCCGTTTCCCTCTTTTCTGCTTTTGTCGCGGCCGATGGCTGATGCTGATGCTGGACGTGGCGCTGATGCAGGTGCAAGACGTG
GGTGCGGAGAAGGACGCCATCACCTCGCTGCGGGCCCCGACGCACTACGGGCGCCCGAACTGGGACAGGGTCTTCAGCTCCATCGCAGAGAAGCACCCCGAGACGGACGTCGGCGTG
GTA
CGTGCCCCCTCTCTCCGCGCGTGTCCCTGCCCGGCCTCACCGAATGCCCGTGTCCGTGTCCGTGTCCGCGCGCCAGTTCTTCTGCGGCCCGGCCGTGCTGTCGAAGCAGCTGCACATCTC
CTGCAACAAGTACTCGACGCCGAGCGGCACCAAGTTCTTCTTCGGAAAAG
GTGCGTCGGAGCGTCGTTGTGCGCGGGCGCTTTGCTGACCCTCGTTCTCGTTCTCATTCTCCTCCCTGTC
CTGCGCAGAGAATTTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTAACTGGACCAAACGCTCCTCTGACCTCGATTTCTCTGACGGCAAGTTGCCGCTCGCCCAGCACCCTGACATGGACAACCCGTTCGCGGACCAGGGCATGCAGCCCAGCCAC
CTCCAGCGCAACAAGTCGGAGCGCAGGCGCCTCCAGCCGCTTCAGCGGTCCAACACCGTCGGCACCATCACCTCCACACCCTACAAGCCCGAAACGTGGGTCGACAGATGGCGTCTGTGG
ATGATCAACGAGGGCGGGAAGCGGCTCTTCTTCACCTTCTTCGTCCTTCTCCACGTCCTCGTCATCGTCTTCGGCTTCTTGTACTACGATACGAGTGATGATCTCAAAGGCGCCCGCAAG
ACATTCGGTATTACCTACC
CTATCGCGCGTTCCGCGGCGCTGGTCCTGCACGTCGAGGTGGCGTTCATCCTGCTGCCCATCTGCCGCAACTTCATCTCGCTGCTCCGGCGCACGCCGCTC
AACTCGTACATCCCTTTTGACAAGAACATCACCTTCCACAAGGCCGTCGCTTGGGGCATCTGTCTCTTCACCTTCATCCACATCGCCGCGCACATGGTCAACTTTGCGCGCCTCGCGTTC
GCCGACCCGCTCGCCAAGACGCCGGGCGAACGTTTCGTCGTCTGGCTCATCGCGAACTTCACGACGGGCCCCGGCGTTACCGGCTGGATCATGACCGCCTCCCTCGCCATCATGGTGTGG
TACGCGATCGAGAAGCGCCGCCGCGCGAACTTTGAGAAGTTCTGGTACACGCATCACCTGTTCATCGTCTTCTTCCTGAACTGGCAGCTGCACGGCATGTTCTGCATGATCCAGCCCGAC
CGCGAGCCGTTCTGCACGTGGAACTCCATCGGTGTCTTCTGG
CGCTACTGGCTTACTGGCGGTGTGATCTTCACCTTCGAGCGTATCCTCCGTGAAGTGCGCTCCCGCCACCGGACCTAC
ATCTCCAAGGTCATCCAGCACCCGTCGAACGTCATGGAACTCCAGATCAAGAAGGAGAAGACGACAACGCGGGCCGGACAGTACATCTTCCTCTCCTGCCCGGAGATCTCGTACTTCCAG
TGGCACCCCTTCACGCTCACGAG
CGCGCCGGAGGAAGACTACATCTCGGTGCATATCCGTATCGTCGGCGACTTCACGCGGGAGCTCGCGGCCGCGGTCGGCTGCGACTTCGACTCGAAG
GAGAAGGGCGTGGAGGCCGGCGGGAAGCTCATCGGCACGAACACGAACCCGCCCGTGAACCGCGTCCTGCCGCGCGTGATGGTCGACGGGCCCTTCGGCTCCGCGTCCGAGGATTTCCTC
AACTACGAGACCGTCCTCCTCGTCGGTGCCGGTATCGGCGTCACGCCGTTTGCCTC
GATCCTGAAGTCTATCTGGTACCGCATGAACAACCTTAACAACTCGAAGCCAACGCGGCTGTCG
AAG
GTCTACTTCACCTGGGTCATCCGTGACTTTGGCAGCGCCGAATGGTTCCACTCGCTCCTGCAGGCCATCGAGGAGCAGGACACGCAGAACCGCATCGAGATCAACATCTACCTCACC
GCGAAGATCAAGGAGGACGACATGAACAACATCATT
GTGCAAGACGTGGGTGCGGAGAAGGACGCCATCACCTCGCTGCGGGCCCCGACGCACTACGGGCGCCCGAACTGGGACAGGGTC
TTCAGCTCCATCGCAGAGAAGCACCCCGAGACGGACGTCGGCGTG
TTCTTCTGCGGCCCGGCCGTGCTGTCGAAGCAGCTGCACATCTCCTGCAACAAGTACTCGACGCCGAGCGGCACC
AAGTTCTTCTTCGGAAAAG
AGAATTTCTGA

Retrieve as FASTA