Entry information : PplNOx02-1B (PplNOx02b)
Entry ID 6755
Creation 2009-05-04 (Christophe Dunand)
Last sequence changes 2009-05-04 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-04-19 (Catherine Mathe)
Peroxidase information: PplNOx02-1B (PplNOx02b)
Name (synonym) PplNOx02-1B (PplNOx02b)
Class Ancestral NADPH oxidase    [Orthogroup: NOx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplNOx02-1B
start..stop
S start..stop
PplNOx02-1A 1261 0 1..609 1..609
PcarNOx02 1021 0 7..609 7..611
PcNOx02 1013 0 7..609 8..609
LbiNOx02 957 0 8..609 5..604
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76251..76629 379 N° 2 76688..77190 503 N° 3 77248..77468 221 N° 4 77537..77809 273
N° 5 77923..77989 67 N° 6 78221..78373 153 N° 7 78523..78651 129 N° 8 78731..78824 94
N° 9 78908..78918 11  
join(76251..76629,76688..77190,77248..77468,77537..77809,77923..77989,78221..783 73,78523..78651,78731..78824,78908..78918)


exon

Literature and cross-references PplNOx02-1B (PplNOx02b)
DNA ref. JGI genome:   scaffold_108 (76251..78918)
mRNA ref. JGI transcript:   108206
EST ref. GenBank:   FL609598.1 [5' end]   FL606128.1 [Fragment]
Protein sequence: PplNOx02-1B (PplNOx02b)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   609
PWM (Da):   %s   69781.84 Transmb domain:   %s   i89-111o126-148i178-200o220-242i255-277o292-310i439-461o
PI (pH):   %s   9.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAANWTKRSSDLDFSDGKLPLAQHPDMDNPFADQGMQPGHLQRNKSERRRLQPLQRSNTVGTIASTPYKPETWIDRWRLWMINEGGKRLFFTFFILLHVLVIVFGFLYYDTSDDLKGARKTFGITYPIARSAALVLHVEVAFILLPICRNFISLLRRTPLNSYIPFDKNITFHKAVAWGICLFTFIHIAAHMVNFARLAFADPLAKTPGERFVVWLIANFTTGPGVTGWIMTAALAIMVWYAVEKRRRANFEKFWYTHHLFIVFFLNWQLHGMFCMIQPDREPFCTWNSIGVFRYWLTGGVIFTFERILREVRSRHRTYISKVIQHPSNVMELQIKKEKTTTRAGQYIFLSCPEISYFQWHPFTLTSAPEEDYISVHIRIVGDFTRELAAAVGCDFDSKEKGVEAGGKLIGTNTNPPVNRVLPRVMVDGPFGSASEDFLNYETVLLVGAGIGVTPFASILKSIWYRMNNLNNSKPTRLSVYFTWVIRDFGSAEWFHSLLQAIEEQDTQNRIEINIYLTAKIKEDDMNNIIVQDVGAEKDAITSLRAPTHYGRPNWDRVFSSIAEKHPETDVGVFFCGPAVLSKQLHISCNKYSSPSGTKFFFGKENF

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 7 ESTs. Duplicated sequence.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTAACTGGACCAAACGCTCCTCTGACCTCGATTTCTCTGACGGCAAGTTGCCGCTCGCCCAGCACCCTGACATGGACAACCCGTTCGCGGACCAGGGCATGCAGCCCGGCCAC
CTCCAGCGCAACAAGTCGGAGCGCAGGCGCCTCCAGCCGCTTCAGCGGTCCAACACCGTCGGCACCATCGCCTCCACACCCTACAAGCCCGAAACGTGGATCGACAGATGGCGTCTGTGG
ATGATTAACGAGGGCGGGAAGCGGCTCTTCTTCACCTTCTTCATCCTTCTCCACGTCCTCGTCATCGTCTTCGGCTTCTTGTACTACGATACGAGTGATGATCTCAAAGGCGCCCGCAAG
ACGTTCGGTATTACCTACC
GTGAGTACCGTGTCGTATGTGCTACCTTACCTAGAAACGTGCTGAGTCGCGCCCCAAGCTATCGCGCGTTCCGCGGCGCTGGTCCTGCACGTCGAGGTGGC
GTTCATCCTGCTGCCCATCTGCCGGAACTTCATCTCGCTGCTCCGGCGCACGCCGCTCAACTCGTACATTCCTTTCGACAAGAACATCACCTTCCACAAGGCCGTCGCCTGGGGCATCTG
TCTCTTCACCTTCATCCACATCGCCGCGCACATGGTCAACTTTGCGCGCCTCGCGTTTGCCGACCCGCTCGCCAAGACGCCGGGCGAACGTTTCGTCGTCTGGCTCATCGCGAACTTCAC
GACGGGCCCCGGCGTCACCGGCTGGATCATGACCGCCGCCCTCGCCATCATGGTGTGGTACGCGGTCGAGAAGCGCCGCCGCGCGAACTTCGAGAAGTTCTGGTACACGCACCACTTGTT
CATCGTCTTCTTCCTGAACTGGCAGCTGCACGGCATGTTCTGCATGATCCAGCCCGACCGCGAGCCGTTCTGCACGTGGAACTCCATCGGTGTCTTCTGG
GTATGTGTTGCACCGGGATG
AGCAGAGTGTTGGAGACGGCTGACCGCGGGATTGCAGCGCTACTGGCTTACTGGCGGTGTGATCTTCACCTTCGAGCGTATCCTCCGTGAAGTGCGCTCCCGCCACCGGACCTACATCTC
CAAGGTCATCCAGCACCCGTCGAACGTCATGGAGCTCCAGATCAAGAAGGAGAAGACGACGACGCGGGCCGGACAGTACATCTTCCTCTCCTGCCCGGAGATCTCGTACTTCCAGTGGCA
CCCCTTCACGCTCACGAG
GTACGCAGCCGCACACTTACCCGCCGAATTTGATGTAATTGCGCGCGAATTGCTCACGTATGCCGCAGCGCGCCGGAGGAAGACTACATCTCGGTGCATATC
CGTATCGTCGGCGACTTTACGCGGGAGCTCGCGGCCGCGGTCGGCTGCGACTTCGACTCGAAGGAGAAGGGCGTGGAGGCCGGCGGGAAGCTCATCGGCACGAACACGAACCCGCCCGTG
AACCGCGTCCTGCCGCGCGTGATGGTCGACGGGCCCTTCGGCTCCGCGTCCGAGGATTTCCTCAACTACGAGACCGTCCTCCTCGTCGGTGCCGGTATCGGCGTCACGCCGTTTGCCTC
G
TGCGTCTCCCGTTTCCTTCCTCGTCGCCAGGGTGTGTGATCTGACCGTCTTCTGTCTTCTGTTTCTTGTTTTCTGTTCTGTTGCACCCTGTACGCTTCGTCGGCGCGCGCAGGATCCTGA
AGTCTATCTGGTACCGTATGAACAACCTAAACAACTCGAAGCCGACGCGGCTGTCGAAG
GTGAGCAGACGCGCGCCAGGCGGTTTCTCTCCCCCGAGCTTCCATCGCAGGCCATCCGTTT
TCCTGTCCTTCTATCAATGTGTGCCCTGCATCCGTCCCTGTGTCCCTGTACCCGTGTCCAGCCGGCACGCTGTTCGGGTGGCCATCCACATCCACATCCACATGCACCTCCTCCATCTCT
TTTCATGTATATTTTAGGCGCACGGAGGCTGACCGCGCCCGCTTGCACAGGTCTACTTCACCTGGGTCATCCGTGACTTTGGCAGCGCCGAATGGTTCCACTCGCTCCTGCAGGCCATCG
AGGAGCAGGACACGCAGAACCGCATCGAGATCAACATCTACCTCACCGCGAAGATCAAGGAGGACGACATGAACAACATCATT
GTGCGCGCTGTTCCCTATTGTCCCCTATCTGTCTCTT
GCCCCTCCGCTCCCCTCCCCTTGTTTTTTTTTTCACCCTCTTCCCGTTTCCCTCTTTCTGCGTTTGTCGCTGCCGATGGCTGACGCTGATGATGGACGTGGCGCTGATGCAGGTGCAAGA
CGTGGGTGCGGAGAAGGACGCCATCACCTCGCTGCGGGCCCCGACGCACTACGGGCGCCCGAACTGGGACAGGGTCTTCAGCTCCATCGCGGAGAAGCACCCCGAGACGGACGTCGGCGT
G
GTACGTGCCCCCTCTCTCCGCGCGTGTCCCTGCCCGGCCTCACCGCGTGTCCGTGTCCGTGTCCGTGTCCGCGCGCCAGTTCTTCTGCGGCCCGGCCGTGCTGTCGAAGCAGCTGCACA
TCTCCTGCAACAAGTACTCGTCGCCGAGCGGCACCAAGTTCTTCTTCGGAAAAG
GTGCGTCGCCGCGTCGGCGTGTCGTTGTGCGCGGGCGCTTTGCTGACCCTCGTTCTCCTCGTTCTC
CTTCCTGTCCTGCGCAGAGAATTTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTAACTGGACCAAACGCTCCTCTGACCTCGATTTCTCTGACGGCAAGTTGCCGCTCGCCCAGCACCCTGACATGGACAACCCGTTCGCGGACCAGGGCATGCAGCCCGGCCAC
CTCCAGCGCAACAAGTCGGAGCGCAGGCGCCTCCAGCCGCTTCAGCGGTCCAACACCGTCGGCACCATCGCCTCCACACCCTACAAGCCCGAAACGTGGATCGACAGATGGCGTCTGTGG
ATGATTAACGAGGGCGGGAAGCGGCTCTTCTTCACCTTCTTCATCCTTCTCCACGTCCTCGTCATCGTCTTCGGCTTCTTGTACTACGATACGAGTGATGATCTCAAAGGCGCCCGCAAG
ACGTTCGGTATTACCTACC
CTATCGCGCGTTCCGCGGCGCTGGTCCTGCACGTCGAGGTGGCGTTCATCCTGCTGCCCATCTGCCGGAACTTCATCTCGCTGCTCCGGCGCACGCCGCTC
AACTCGTACATTCCTTTCGACAAGAACATCACCTTCCACAAGGCCGTCGCCTGGGGCATCTGTCTCTTCACCTTCATCCACATCGCCGCGCACATGGTCAACTTTGCGCGCCTCGCGTTT
GCCGACCCGCTCGCCAAGACGCCGGGCGAACGTTTCGTCGTCTGGCTCATCGCGAACTTCACGACGGGCCCCGGCGTCACCGGCTGGATCATGACCGCCGCCCTCGCCATCATGGTGTGG
TACGCGGTCGAGAAGCGCCGCCGCGCGAACTTCGAGAAGTTCTGGTACACGCACCACTTGTTCATCGTCTTCTTCCTGAACTGGCAGCTGCACGGCATGTTCTGCATGATCCAGCCCGAC
CGCGAGCCGTTCTGCACGTGGAACTCCATCGGTGTCTTCTGG
CGCTACTGGCTTACTGGCGGTGTGATCTTCACCTTCGAGCGTATCCTCCGTGAAGTGCGCTCCCGCCACCGGACCTAC
ATCTCCAAGGTCATCCAGCACCCGTCGAACGTCATGGAGCTCCAGATCAAGAAGGAGAAGACGACGACGCGGGCCGGACAGTACATCTTCCTCTCCTGCCCGGAGATCTCGTACTTCCAG
TGGCACCCCTTCACGCTCACGAG
CGCGCCGGAGGAAGACTACATCTCGGTGCATATCCGTATCGTCGGCGACTTTACGCGGGAGCTCGCGGCCGCGGTCGGCTGCGACTTCGACTCGAAG
GAGAAGGGCGTGGAGGCCGGCGGGAAGCTCATCGGCACGAACACGAACCCGCCCGTGAACCGCGTCCTGCCGCGCGTGATGGTCGACGGGCCCTTCGGCTCCGCGTCCGAGGATTTCCTC
AACTACGAGACCGTCCTCCTCGTCGGTGCCGGTATCGGCGTCACGCCGTTTGCCTC
GATCCTGAAGTCTATCTGGTACCGTATGAACAACCTAAACAACTCGAAGCCGACGCGGCTGTCG
AAG
GTCTACTTCACCTGGGTCATCCGTGACTTTGGCAGCGCCGAATGGTTCCACTCGCTCCTGCAGGCCATCGAGGAGCAGGACACGCAGAACCGCATCGAGATCAACATCTACCTCACC
GCGAAGATCAAGGAGGACGACATGAACAACATCATT
GTGCAAGACGTGGGTGCGGAGAAGGACGCCATCACCTCGCTGCGGGCCCCGACGCACTACGGGCGCCCGAACTGGGACAGGGTC
TTCAGCTCCATCGCGGAGAAGCACCCCGAGACGGACGTCGGCGTG
TTCTTCTGCGGCCCGGCCGTGCTGTCGAAGCAGCTGCACATCTCCTGCAACAAGTACTCGTCGCCGAGCGGCACC
AAGTTCTTCTTCGGAAAAG
AGAATTTCTGA

Retrieve as FASTA