Entry information : Pbl1CysPrx01
Entry ID 6757
Creation 2009-05-05 (Christophe Dunand)
Last sequence changes 2009-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Pbl1CysPrx01
Name Pbl1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pbl1CysPrx01
start..stop
S start..stop
Pbl1CysPrx02 385 2e-138 1..217 1..217
Hcy1CysPrx 327 2e-115 2..214 3..218
Pcar1CysPrx01 323 3e-114 2..214 3..218
Gve1CysPrx 322 9e-114 3..217 1..214
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 420725..420755 31 N° 2 420869..420961 93 N° 3 421147..421364 218 N° 4 421495..421806 312
join(420725..420755,420869..420961,421147..421364,421495..421806)


exon

Literature and cross-references Pbl1CysPrx01
DNA ref. JGI genome:   scaffold_34 (420725..421806)
mRNA ref. JGI transcript:   58117
Protein sequence: Pbl1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   24061.67  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRLGSIAPDFEALTTKGPIKFHEFIGEKWAVLFSHPADFTPVCTTELGLVAALQDEFDARNVKVIGLSANGLESHQKWISDINEISNVQLDFPIIADDNRKVSVLYDMLDHDATNLDAKGIPFTIRSVFIIDPKKTIRLILSYPASTGRNFDEILRVIDSLQLGDKHRITTPGNWKKGDDVIVHPSVSTEEAQTLFPKGVRVVKPYLRLTPSPF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCAGACTTGGATCTATTGCCCCAGGTAAATTTATTTTCACATATAAATATTGAACAATTGATATTTGTGTTTGTGTGTGTGTGCGCTTGAGTTTGTGCTTTTAAACTAAATGT
ATATGTTCGTGAAAATGTTTGTAGACTTTGAAGCCTTGACCACAAAGGGTCCTATCAAGTTTCACGAATTCATTGGTGAAAAATGGGCCGTTTTGTTCTCTCACCCTGCAGATTTCAGTA
AGTGAGGTTTAGTATATTCTGATAAGCGAAAAGAAGGAGGGAAGGAAGAAAAGACAAAGAGAGAAACAGAAAAAGAAATCAATGTTTTCTTCAAGTCAAATGTTTCTTCTTATGCTTGTA
TTAAATGGTCTTGGACTATATATTAATTCCCGGATTTTTTGATATTTTTTTTTAAAAATAAGCTCCTGTGTGTACCACTGAGTTGGGGCTGGTGGCTGCTCTCCAAGATGAATTTGATGC
TCGTAACGTCAAGGTGATTGGTTTGTCTGCAAATGGCTTAGAGTCGCACCAAAAGTGGATCTCGGATATCAATGAGATTAGCAATGTTCAGCTTGATTTCCCTATTATCGCTGATGACAA
CCGCAAGGTTTCTGTGCTCTATGACATGCTTGACCACCAA
GTAAGTTTATATACTGTTTTGTGTTTTGTTCTTTGGTATAATCTAGTATAGTCAATACACTACCAAGAAGATTATGATAT
TAACAGCATTAAACTAATATAATAAAAAAAATGATATAATTTTATTATAGGATGCTACTAACCTTGACGCCAAGGGTATTCCATTCACCATTCGATCGGTGTTTATTATCGACCCCAAAA
AGACCATCCGTCTCATCCTGTCCTACCCTGCGTCGACTGGCCGCAACTTTGACGAAATATTGCGTGTGATCGACTCTCTGCAGCTTGGAGACAAACATCGTATCACTACACCTGGAAACT
GGAAAAAGGGAGACGATGTGATTGTTCACCCAAGTGTGTCAACCGAAGAAGCCCAGACCTTGTTCCCAAAGGGTGTCCGCGTGGTCAAGCCTTATTTGCGCCTCACTCCTTCACCTTTCT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCAGACTTGGATCTATTGCCCCAGACTTTGAAGCCTTGACCACAAAGGGTCCTATCAAGTTTCACGAATTCATTGGTGAAAAATGGGCCGTTTTGTTCTCTCACCCTGCAGAT
TTCA
CTCCTGTGTGTACCACTGAGTTGGGGCTGGTGGCTGCTCTCCAAGATGAATTTGATGCTCGTAACGTCAAGGTGATTGGTTTGTCTGCAAATGGCTTAGAGTCGCACCAAAAGTGG
ATCTCGGATATCAATGAGATTAGCAATGTTCAGCTTGATTTCCCTATTATCGCTGATGACAACCGCAAGGTTTCTGTGCTCTATGACATGCTTGACCACCAA
GATGCTACTAACCTTGAC
GCCAAGGGTATTCCATTCACCATTCGATCGGTGTTTATTATCGACCCCAAAAAGACCATCCGTCTCATCCTGTCCTACCCTGCGTCGACTGGCCGCAACTTTGACGAAATATTGCGTGTG
ATCGACTCTCTGCAGCTTGGAGACAAACATCGTATCACTACACCTGGAAACTGGAAAAAGGGAGACGATGTGATTGTTCACCCAAGTGTGTCAACCGAAGAAGCCCAGACCTTGTTCCCA
AAGGGTGTCCGCGTGGTCAAGCCTTATTTGCGCCTCACTCCTTCACCTTTCTAA

Retrieve as FASTA