Entry information : Pbl2CysPrx01
Entry ID 6758
Creation 2009-05-05 (Christophe Dunand)
Last sequence changes 2009-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Pbl2CysPrx01
Name Pbl2CysPrx01
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pbl2CysPrx01
start..stop
S start..stop
Sdic2CysPrx03 311 7e-110 1..195 1..198
Tcas2CysPrx 303 9e-107 2..195 3..196
Bmor2CysPrx02 300 9e-106 1..195 1..195
Amel2CysPrx02 299 3e-105 1..194 1..194
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 892020..892023 4 N° 2 891722..891946 225 N° 3 891270..891628 359  
complement(join(891270..891628,891722..891946,892020..892023))


exon

Literature and cross-references Pbl2CysPrx01
DNA ref. JGI genome:   scaffold_19 (892023..891270)
mRNA ref. JGI transcript:   28481
EST ref. GenBank:   EX833802.1
Protein sequence: Pbl2CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   195
PWM (Da):   %s   21596.19  
PI (pH):   %s   5.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAQVQKPAPAFTAPAVVNGEFKDISLSDYKGKYVVFFWYPMDFTFVCPTEILAFSERVKEFEALNTVVIGASTDSEFSHLAWINTPRKQGGLGEMKIPLLADKTKSIARDYGVLIEEAGIALRGLFIIDPKGTVRQITINDLPVGRNVDEILRLVEAFQFTDVHGEVCPANWTKGSKTIKPDVKQSKEYFESSN

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 85 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAAGCAACAAGAGCTGTTTTAAAAAGATTAATAATGAAATACTCTACCGCACTTTACTCACACCTCTTGTAGTTGCCCAAGTTCAGAAGCCCGCCCCTGCCTTCACCGCCCCTGC
TGTTGTTAACGGCGAGTTCAAGGATATCTCTTTGTCCGACTACAAGGGCAAGTACGTTGTCTTCTTCTGGTATCCCATGGACTTCACCTTTGTCTGCCCCACCGAGATCCTCGCCTTCTC
TGAGCGCGTCAAGGAGTTCGAGGCCCTCAACACCGTTGTCATTGGTGCTTCCACCGACTCTG
GTAAGCTTTGATTTCAATTTTTTTTTTGATTGGCTAGTTTGGGGGAGGACGATAAATA
CACAAATATATGAACGCGTACTAACCATCCTATAGAGTTCTCTCACTTGGCCTGGATTAACACTCCTCGCAAGCAGGGTGGTCTCGGTGAGATGAAGATCCCTCTTTTGGCCGATAAGAC
CAAGAGCATTGCCCGTGACTACGGTGTTTTGATTGAGGAAGCCGGTATTGCTCTCCGTGGTCTCTTCATCATTGACCCCAAGGGTACCGTCCGTCAGATCACCATCAACGATCTCCCCGT
CGGCCGTAACGTTGATGAGATCCTCCGTCTCGTTGAGGCTTTCCAGTTCACTGATGTCCACGGTGAGGTCTGCCCCGCCAACTGGACCAAGGGCTCTAAGACCATCAAGCCCGATGTCAA
GCAGTCCAAGGAGTACTTTGAGTCCTCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCCCAAGTTCAGAAGCCCGCCCCTGCCTTCACCGCCCCTGCTGTTGTTAACGGCGAGTTCAAGGATATCTCTTTGTCCGACTACAAGGGCAAGTACGTTGTCTTCTTCTGGTAT
CCCATGGACTTCACCTTTGTCTGCCCCACCGAGATCCTCGCCTTCTCTGAGCGCGTCAAGGAGTTCGAGGCCCTCAACACCGTTGTCATTGGTGCTTCCACCGACTCTG
AGTTCTCTCAC
TTGGCCTGGATTAACACTCCTCGCAAGCAGGGTGGTCTCGGTGAGATGAAGATCCCTCTTTTGGCCGATAAGACCAAGAGCATTGCCCGTGACTACGGTGTTTTGATTGAGGAAGCCGGT
ATTGCTCTCCGTGGTCTCTTCATCATTGACCCCAAGGGTACCGTCCGTCAGATCACCATCAACGATCTCCCCGTCGGCCGTAACGTTGATGAGATCCTCCGTCTCGTTGAGGCTTTCCAG
TTCACTGATGTCCACGGTGAGGTCTGCCCCGCCAACTGGACCAAGGGCTCTAAGACCATCAAGCCCGATGTCAAGCAGTCCAAGGAGTACTTTGAGTCCTCCAACTAA

Retrieve as FASTA