Entry information : Pbl1CysPrx02
Entry ID 6759
Creation 2009-05-05 (Christophe Dunand)
Last sequence changes 2009-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Pbl1CysPrx02
Name Pbl1CysPrx02
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pbl1CysPrx02
start..stop
S start..stop
Pbl1CysPrx01 385 2e-138 1..217 1..217
Gve1CysPrx 316 2e-111 3..217 1..214
Pcar1CysPrx01 314 3e-110 2..214 3..218
Hcy1CysPrx 313 7e-110 2..214 3..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1972589..1972619 31 N° 2 1972680..1972772 93 N° 3 1972877..1973094 218 N° 4 1973155..1973466 312
join(1972589..1972619,1972680..1972772,1972877..1973094,1973155..1973466)


exon

Literature and cross-references Pbl1CysPrx02
DNA ref. JGI genome:   scaffold_6 (1972589..1973466)
mRNA ref. JGI transcript:   56644
Protein sequence: Pbl1CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   24236.69  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLRLGSIAPDFVAQTTKGELRFHEYIDQHWAIMFSHPADFTPVCTTELGLVAALQGEFDARQVKIIGLSANGLEEHTKWIADINELSNVQLEFPIIADADRKISVLYDMLDKDATNVDNGGLPFTIRSVFIIDPKKTIRLIMAYPASTGRNFDEILRVIDSLQLGDKHRITTPGNWKRGDDVIVHPSVPTEEAKKIFPKGVRVLKPYLRMTPSPF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACTTCGCCTTGGGTCTATTGCACCTGGTAAACAGTGCGCCTATTAAAGGGCTCATTGGACTGATGCGTAAATTTATTGTCCTACAGACTTTGTGGCCCAAACTACAAAAGGTGAA
CTCAGATTCCATGAGTATATCGATCAGCATTGGGCTATTATGTTCTCCCATCCCGCAGATTTTA
GTAAGCTTTTCATCTTAAGTCTCAAATATCTTTAAATACTGCTAGTGAGTAATGTT
TTTTTTTACACCGATATCTAAACTTATGTCTCTTCGCTTTTTTTTTAGCTCCTGTTTGCACAACTGAGCTCGGGTTAGTTGCTGCTCTACAGGGCGAGTTTGATGCTCGTCAAGTCAAGA
TAATTGGTCTTTCTGCCAATGGTCTCGAAGAGCACACTAAGTGGATAGCAGATATCAATGAACTCAGTAATGTTCAGCTTGAATTTCCAATTATTGCCGACGCCGATCGTAAAATTTCTG
TTCTATATGACATGCTCGACAAACAA
GTAAAAAGAAGTGTTTGATTGCTATGCTATCATATCCGTACTAATTTATTGGAAAATTAGGACGCCACTAACGTCGATAATGGTGGCTTACCGT
TCACTATCCGTTCAGTGTTTATCATTGACCCCAAAAAGACCATTCGGTTAATTATGGCATACCCTGCCTCAACCGGACGTAACTTTGATGAAATATTGCGTGTTATTGACTCGCTTCAGT
TGGGCGACAAACATCGAATCACCACGCCCGGGAATTGGAAAAGGGGCGACGATGTTATTGTCCATCCTTCAGTACCAACTGAAGAAGCCAAAAAGATATTTCCAAAAGGTGTGCGTGTGC
TTAAACCTTACTTGCGCATGACACCCTCTCCTTTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACTTCGCCTTGGGTCTATTGCACCTGACTTTGTGGCCCAAACTACAAAAGGTGAACTCAGATTCCATGAGTATATCGATCAGCATTGGGCTATTATGTTCTCCCATCCCGCAGAT
TTTA
CTCCTGTTTGCACAACTGAGCTCGGGTTAGTTGCTGCTCTACAGGGCGAGTTTGATGCTCGTCAAGTCAAGATAATTGGTCTTTCTGCCAATGGTCTCGAAGAGCACACTAAGTGG
ATAGCAGATATCAATGAACTCAGTAATGTTCAGCTTGAATTTCCAATTATTGCCGACGCCGATCGTAAAATTTCTGTTCTATATGACATGCTCGACAAACAA
GACGCCACTAACGTCGAT
AATGGTGGCTTACCGTTCACTATCCGTTCAGTGTTTATCATTGACCCCAAAAAGACCATTCGGTTAATTATGGCATACCCTGCCTCAACCGGACGTAACTTTGATGAAATATTGCGTGTT
ATTGACTCGCTTCAGTTGGGCGACAAACATCGAATCACCACGCCCGGGAATTGGAAAAGGGGCGACGATGTTATTGTCCATCCTTCAGTACCAACTGAAGAAGCCAAAAAGATATTTCCA
AAAGGTGTGCGTGTGCTTAAACCTTACTTGCGCATGACACCCTCTCCTTTTTGA

Retrieve as FASTA