Entry information : Pbl2CysPrx02
Entry ID 6760
Creation 2009-05-05 (Christophe Dunand)
Last sequence changes 2009-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Pbl2CysPrx02
Name Pbl2CysPrx02
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pbl2CysPrx02
start..stop
S start..stop
Pbl2CysPrx01 270 4e-93 49..242 2..195
Tad2CysPrx01 267 5e-91 14..238 26..243
Pi2CysPrx03 264 2e-90 52..242 5..198
Spur2CysPrx03 265 5e-90 43..242 65..264
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 966348..966507 160 N° 2 966092..966183 92 N° 3 965758..965870 113 N° 4 965519..965538 20
N° 5 965343..965399 57 N° 6 965209..965247 39 N° 7 964944..965104 161 N° 8 964647..964733 87
complement(join(964647..964733,964944..965104,965209..965247,965343..965399,9655 19..965538,965758..965870,966092..966183,966348..966507))


exon

Literature and cross-references Pbl2CysPrx02
DNA ref. JGI genome:   scaffold_7 (966507..964647)
mRNA ref. JGI transcript:   30690
EST ref. GenBank:   EX862684.1
Protein sequence: Pbl2CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   26360.96  
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTFSRVSRILPRASLALASRPVSRPVLGAVRPAFNTLRNFSSTSPKSIATVQHAAPQWIGDAVVDGEFKQLSLADYKGKFAVVFYPADFTFVCPTELLAYSDRIEEFRALGAEVIGISVDNVHSHAWTNVPRKQGGLGAIQIPLVSDIKKDISADYNVLIPEAGIALRGLFVIDPKGTLRVAHVHDLPIGRSVDETLRIIEAIKFTDEHGEVCPANWKKGDKTIKPNPKGSQEYFESVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACCTTTTCTCGTGTTTCTCGTATCCTTCCTCGCGCCTCTTTGGCTCTTGCCTCGCGTCCAGTTAGCCGTCCTGTTCTCGGTGCCGTCCGTCCTGCATTCAACACTCTGCGTAAC
TTTTCCTCTACCAGCCCAAAGTCTATCGCTACTGTCCAGC
GTAAGCTTTCTTTCTTTTTTGTAAAAAATAAACAAACAAACAAATAAATAAATAAAAATACAATTGAAGGGTTTTCTTTT
TATTATTATTAAATTAAATGTATGAATATATACACAAGCACAAAACAATTAAATAAACAAATAAAAACACCGTGTTTTGCATAGACGCTGCTCCTCAGTGGATTGGTGATGCCGTTGTTG
ACGGTGAATTCAAGCAATTGTCTTTGGCTGACTACAAGGGCAAGTTTGCAGTATTG
GTAAATAACTCCCCTTTTTAAAATACCAATCAATCAATCAATCAATCAATCAGTCAGTCAGTCA
GTCAGTCGAACAAACAAACGAACAAACAAACAAACAAACAAATATATATATAGAGAGAGAGAGAGAAGGGGGAGGGGGGGGTTGAGAGAAAGGGCGTTCCTTGGTTTTTTCTTCTAGCTA
TTTGATTCACTTATGTTTTTCTCTTTTTTAAAAAAAGGTCTTTTATCCTGCTGACTTTACCTTTGTTTGCCCCACCGAATTGCTTGCATACAGCGATCGTATTGAAGAGTTCCGTGCATT
GGGTGCCGAGGTTATTGGTATCAGTGTAGA
GTAAGTGAAGTTTGAATTTGAGTTGTAAAGTATAGGCAAGGCTTTTGAATATCAAATCGGCGATTGTATATACGTGATTTTGAGATTCAA
AAAATTTAAAGTTTTGATTTGGAGATTTGAAACAAAACAAAAAAAAAGATATATGCATATGATTTTACGTTTGATTATATATATATATATTGATTTATTGATTTATATATATATTATTTT
ATTTTATAGCAATGTCCATTCTCACTTGGGTAAGAAGTGAATAAAATTCTTTCTTGGATTATTAATATTATTATTAATTGATCATAACAATTACAAACCAAAATCTGATAAACTAATATA
TTTATATATTTATATTTAATTTTAATAGCTTGGACTAATGTACCCAGAAAGCAGGGTGGTCTTGGTGCTATCCAGATTCCTCTTGGTAAATGAAATACATTACTTATATACGTGAAAGGG
TATATTTCCTCCAACTAATTTGCTTTTTTTTTTTAAAAAAAAAAAAAAACCTACAATTAGTTTCTGATATCAAGAAAGATATTTCGGCCGATTACAATGGTAAATCATGATTTTAGATTA
ACAAAAAAGAAAAAGAAAAAGAAAAAGACCCCTTTTTCTTACCCTCTTATTTTGATTTTTTTCTTTCTCTCTCTCTCTCTTAGTATTGATCCCTGAGGCTGGAATTGCTCTCCGTGGTCT
GTTTGTCATTGATCCAAAGGGTACACTTCGCGTGGCTCACGTTCATGATCTTCCCATTGGTCGTTCCGTCGATGAGACTCTTAGAATCATCGAGGCTATCAAATTCACTGATGAGCATGG
AGAG
GTATTTAGATCTATTAACTAAGAAGAATTGGATATATATATATATTAGTTGGGATATGGATGTGTGGGATTTGCTTTGGATCTACGGCGCCTTCCTTTCCTCTCCTGTTTATATTA
CTATTTTCTTCTTCTTCTTTGGCGTGTGGATCTTTCTGTGTGTTTGTTTTTCTTTTATAAAGTTTCTAACTATTATTTTTTTGTTTGTTTTTAGGTTTGCCCTGCCAACTGGAAGAAGGG
TGACAAGACTATCAAGCCTAACCCCAAGGGATCTCAGGAGTACTTTGAATCTGTAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACCTTTTCTCGTGTTTCTCGTATCCTTCCTCGCGCCTCTTTGGCTCTTGCCTCGCGTCCAGTTAGCCGTCCTGTTCTCGGTGCCGTCCGTCCTGCATTCAACACTCTGCGTAAC
TTTTCCTCTACCAGCCCAAAGTCTATCGCTACTGTCCAGC
ACGCTGCTCCTCAGTGGATTGGTGATGCCGTTGTTGACGGTGAATTCAAGCAATTGTCTTTGGCTGACTACAAGGGCAAG
TTTGCAGTATTG
GTCTTTTATCCTGCTGACTTTACCTTTGTTTGCCCCACCGAATTGCTTGCATACAGCGATCGTATTGAAGAGTTCCGTGCATTGGGTGCCGAGGTTATTGGTATCAGT
GTAGA
CAATGTCCATTCTCACTTGGCTTGGACTAATGTACCCAGAAAGCAGGGTGGTCTTGGTGCTATCCAGATTCCTCTTGTTTCTGATATCAAGAAAGATATTTCGGCCGATTACAAT
G
TATTGATCCCTGAGGCTGGAATTGCTCTCCGTGGTCTGTTTGTCATTGATCCAAAGGGTACACTTCGCGTGGCTCACGTTCATGATCTTCCCATTGGTCGTTCCGTCGATGAGACTCTT
AGAATCATCGAGGCTATCAAATTCACTGATGAGCATGGAGAG
GTTTGCCCTGCCAACTGGAAGAAGGGTGACAAGACTATCAAGCCTAACCCCAAGGGATCTCAGGAGTACTTTGAATCT
GTAAACTAA

Retrieve as FASTA