Entry information : PblPrxQ
Entry ID 6763
Creation 2009-05-06 (Christophe Dunand)
Last sequence changes 2009-05-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: PblPrxQ
Name PblPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type Vegetative mycelia
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PblPrxQ
start..stop
S start..stop
GinPrxQ 143 7e-45 3..150 4..150
PabPrxQ23 140 5e-43 11..152 78..217
GvePrxQ 137 2e-42 16..152 1..137
CclPrxQ01 134 2e-40 9..154 72..215
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 954775..954933 159 N° 2 954649..954675 27 N° 3 954398..954564 167 N° 4 954101..954212 112
complement(join(954101..954212,954398..954564,954649..954675,954775..954933))


exon

Literature and cross-references PblPrxQ
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M. and Lindquist,E.A. DOE Joint Genome Institute Phycomyces blakesleeanus EST project
DNA ref. JGI genome:   scaffold_6 (954933..954101)
mRNA ref. JGI transcript:   8330 [Fragment]
EST ref. GenBank:   EX857061.1
Protein sequence: PblPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   155
PWM (Da):   %s   17340.83  
PI (pH):   %s   6.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSHPLINQQAPKSFVLKNDKDESVDLSQIIGDGTHSVVLFFYPKDNTYGCTKEACSFRDNYERISELDAIVMGVSGDSARSHETFVKQHKLPFPLLSDKEGKLRSGLQVPKWYFGLPGRTTYVISKEGVILDVFDSQIGFNQHVTRAIKVLEEN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns) and 2 ESTs. Strain="NRRL1555".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCACCCACTTATCAATCAACAAGCACCCAAGTCTTTTGTCCTCAAGAACGACAAGGACGAGTCTGTTGACCTGTCTCAGATAATAGGCGATGGCACTCACTCGGTTGTTCTCTTT
TTCTACCCCAAAGACAACACTTATGGCTGTACTAAAGAG
GTAAGTGATTGATTTGATTATGCATTTTATAAAAATCAATTCAAATAATAATGAAAAAAAAATTAATCGATTTCTTGTTTT
ATTTTCGCGTTTGTTTAGGCTTGCTCTTTTAGAGATAATTATGAGGTGTGTATGTGTGTAAGATTGGTTCTTTTCAAATACTCAATTGTGTGTTTTGTTTATTTTGGGTTTTTGGGGTTC
ACTCTTTAGAGAATATCTGAATTGGACGCAATTGTTATGGGTGTCAGTGGAGATAGTGCTCGATCACACGAGACCTTTGTAAAGCAACACAAGCTTCCGTTCCCTCTTTTGTCTGACAAG
GAAGGAAAGCTCAGATCAGGGCTCCAGGTCCCTAAATGGTATTTCGGTCTTCCAGG
GTAAGATAAGATTTCTATACAATTGAAATTGAATTGAATTGAATCAAATTGCATTGCATTGAAT
TCAACTCAATTCAATTCAATTCAACACTATTATAATGATGTTTAAACCAAAAGAAAAAAGCTTCGCTCATCTATAATATAGTATAATCTGATATATTTCTAATGGTATTTCTTCTCTCTA
GACGCACTACCTACGTTATCAGCAAGGAGGGCGTTATACTCGATGTATTCGATTCACAAATTGGATTCAATCAGCATGTCACGCGTGCTATCAAGGTGCTTGAAGAGAACAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCACCCACTTATCAATCAACAAGCACCCAAGTCTTTTGTCCTCAAGAACGACAAGGACGAGTCTGTTGACCTGTCTCAGATAATAGGCGATGGCACTCACTCGGTTGTTCTCTTT
TTCTACCCCAAAGACAACACTTATGGCTGTACTAAAGAG
GCTTGCTCTTTTAGAGATAATTATGAGAGAATATCTGAATTGGACGCAATTGTTATGGGTGTCAGTGGAGATAGTGCTCGA
TCACACGAGACCTTTGTAAAGCAACACAAGCTTCCGTTCCCTCTTTTGTCTGACAAGGAAGGAAAGCTCAGATCAGGGCTCCAGGTCCCTAAATGGTATTTCGGTCTTCCAGG
ACGCACT
ACCTACGTTATCAGCAAGGAGGGCGTTATACTCGATGTATTCGATTCACAAATTGGATTCAATCAGCATGTCACGCGTGCTATCAAGGTGCTTGAAGAGAACAAA

Retrieve as FASTA