Entry information : Bde2CysPrx01
Entry ID 6764
Creation 2009-05-06 (Christophe Dunand)
Last sequence changes 2009-05-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Bde2CysPrx01
Name Bde2CysPrx01
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium
Organism Batrachochytrium dendrobatidis    [TaxId: 109871 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Bde2CysPrx01
start..stop
S start..stop
Aeu2CysPrx03-3_201684 259 9e-89 34..227 3..198
Aeu2CysPrx03-4_201684 259 9e-89 34..227 3..198
Pi2CysPrx03 258 2e-88 35..227 4..196
Sdic2CysPrx03 258 3e-88 34..227 3..196
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 261422..261532 111 N° 2 261698..261809 112 N° 3 261895..262065 171 N° 4 262151..262356 206
N° 5 262425..262517 93  
join(261422..261532,261698..261809,261895..262065,262151..262356,262425..262517)


exon

Literature and cross-references Bde2CysPrx01
DNA ref. JGI genome:   scaffold_3 (261422..262517)
mRNA ref. JGI transcript:   86762
Protein sequence: Bde2CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230
PWM (Da):   %s   25029.91  
PI (pH):   %s   7.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLATSMPYPIRSGISCAATHAVFSSSSKSNHTFARVQKPAPAWSATAVVGKEFKKLSSEDFLGKWLVLFFYPLDFTFVCPTEIISYSKAAEEFRKLNTEVVGVSVDSVYSHLAWIEQPRKLGGLGDLDIPLVGDITKNISHNYGVLADSGADIGLSLRGTFIIDPKGTVRQITINDTGVGRNIDETLRLVEALQFVDEHEVCPAGWKKGEKTMIPNPTKSKDYFKSVAE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGCTACATCAATGCCTTATCCCATTCGATCTGGCATTTCTTGTGCCGCTACTCATGCCGTGTTTAGCTCATCTAGCAAGTCAAATCATACATTTGCTAGAGTCCAGGTAACTGTT
TATTGTGCAATAATTTACTAGTTGATATGTTTGGGTTTTGAAGATTGGCTGGCTGTATTTACTGTCAATTCTGGCAGCTTGTATTTATAGATCCTTTAATACCTTGACAATACAGTGTTG
TTATTGACTGACGATTTTATTGTTTGGGCGGTATAGAAACCTGCTCCTGCTTGGTCTGCCACTGCTGTTGTTGGCAAGGAATTTAAAAAATTGTCTTCAGAAGACTTTCTTGGCAAATGG
CTTGTCTTGTTCTTTTACCCTTTGGACT
GTAAGTAAAGCTTTGTTCAGTAATCTCTAGATCATGAAATGGAATCGGTTGAGCTAGTTGAGCTAGCTGACAAATTTCATTGCAGTCACTTT
TGTTTGTCCTACTGAAATCATCAGTTACAGTAAGGCTGCTGAAGAGTTTCGTAAGCTGAATACTGAGGTGGTTGGCGTGTCGGTCGACTCTGTGTACTCTCATTTGGCTTGGATTGAGCA
GCCTCGCAAACTTGGAGGACTTGGCGATCTCGATATTCCACTCG
GTAAGATGACTGGATAAACACCTTGAGAATCACTTGAAATAGATCTATATACTCATTCTCTTGTATTCACATCAAC
TGCTTATAGTTGGCGACATCACCAAAAACATATCCCACAATTATGGTGTGTTGGCTGACAGTGGTGCCGATATTGGATTATCCCTTCGTGGTACATTTATTATTGATCCCAAGGGCACTG
TGCGTCAGATCACCATCAACGACACTGGTGTTGGCCGCAACATTGATGAAACATTACGTTTGGTTGAAGCCTTGCAGTTTGTTGACGAACACGGC
GTAAGCACATACAATTAAACTATTT
GCAATGTTTTGATGTAGATCTAATGCCTATTAAACTATCATAGGAGGTCTGCCCTGCTGGATGGAAAAAGGGTGAAAAAACAATGATTCCTAACCCCACCAAATCCAAAGATTATTTTAA
ATCTGTAGCCGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGCTACATCAATGCCTTATCCCATTCGATCTGGCATTTCTTGTGCCGCTACTCATGCCGTGTTTAGCTCATCTAGCAAGTCAAATCATACATTTGCTAGAGTCCAGAAACCTGCT
CCTGCTTGGTCTGCCACTGCTGTTGTTGGCAAGGAATTTAAAAAATTGTCTTCAGAAGACTTTCTTGGCAAATGGCTTGTCTTGTTCTTTTACCCTTTGGACT
TCACTTTTGTTTGTCCT
ACTGAAATCATCAGTTACAGTAAGGCTGCTGAAGAGTTTCGTAAGCTGAATACTGAGGTGGTTGGCGTGTCGGTCGACTCTGTGTACTCTCATTTGGCTTGGATTGAGCAGCCTCGCAAA
CTTGGAGGACTTGGCGATCTCGATATTCCACTCG
TTGGCGACATCACCAAAAACATATCCCACAATTATGGTGTGTTGGCTGACAGTGGTGCCGATATTGGATTATCCCTTCGTGGTACA
TTTATTATTGATCCCAAGGGCACTGTGCGTCAGATCACCATCAACGACACTGGTGTTGGCCGCAACATTGATGAAACATTACGTTTGGTTGAAGCCTTGCAGTTTGTTGACGAACACGGC
GAGGTCTGCCCTGCTGGATGGAAAAAGGGTGAAAAAACAATGATTCCTAACCCCACCAAATCCAAAGATTATTTTAAATCTGTAGCCGAATAA

Retrieve as FASTA