Entry information : Bde2CysPrx02
Entry ID 6765
Creation 2009-05-06 (Christophe Dunand)
Last sequence changes 2009-05-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Bde2CysPrx02
Name Bde2CysPrx02
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium
Organism Batrachochytrium dendrobatidis    [TaxId: 109871 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Bde2CysPrx02
start..stop
S start..stop
Mbal2CysPrx02 276 1e-95 5..196 6..197
Cre2CysPrx02 274 7e-95 1..194 1..194
Aeu2CysPrx03-3_201684 274 8e-95 1..195 1..197
Aeu2CysPrx03-4_201684 274 1e-94 1..195 1..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 335511..335514 4 N° 2 335240..335365 126 N° 3 334398..334434 37 N° 4 334247..334283 37
N° 5 333996..334173 178 N° 6 333762..333890 129 N° 7 333613..333689 77 N° 8 333334..333417 84
complement(join(333334..333417,333613..333689,333762..333890,333996..334173,3342 47..334283,334398..334434,335240..335365,335511..335514))


exon

Literature and cross-references Bde2CysPrx02
DNA ref. JGI genome:   scaffold_6 (335514..333334)
mRNA ref. JGI transcript:   19546
Protein sequence: Bde2CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   223
PWM (Da):   %s   24512.82  
PI (pH):   %s   8.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVATVQQKAPFFTAQAVVNGAFKEVTLDQYKGKYLVLFFYPLDFTFVCPTEIIAFSDRIEEFKKIGVVVAASVDSQFSHLAWTKQPRLEGGLGDMKIPIIADITKTISRDYGVLVESGSDAGVALRGTFIIDPHQIVRVVQINDLPIGRSVDEVLRLIDALQFHEKHGDVCPVGWKKGSHSMKADPIGSKAYFEEFSQSAGKRKNNADSTSPTKPVKKAHQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). No EST. First exon =ATGG
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTATTATCTACTTGTTGTTTGTCATTTCCTGGATTCTATTTGAATCTTGCCATTTACATTCAAGTGGTGTCAGGGATCCATTGCTATCAACGCATAGATGTTGAATATTAATTAAA
TACTTTACCAATTCATCATGTAAATATAGTTGCAACGGTTCAACAAAAAGCTCCTTTTTTCACTGCCCAGGCTGTTGTCAATGGTGCATTCAAAGAAGTCACTCTCGATCAGTACAAGGG
AAAATACCTTGTTTTATTCTTCTATCCTCTTGACT
GTAAGTGTGTTGAGTTGTAATGGCTTGATAATCGTCATGATCTATGGCATTCCTTGATGAGTTTTTCGAATGGAAAAATTGGAGT
TGGAACCTGCTTTTTTTGCATGCTACATGAAGCGGACAAATACATGGATGTTTAAGCAGTTGATTGTATTCATGCAAAATGAAACACTTGTATTTATCTTGCAATGATTGTCTTTGGAAT
ATATAATGATTACGTATTCCTATTACAATTGACTCGACTGCTTCTTCAACTTTGCTCCAAACACAAATCCATTCTTGATATCGCAAAATCAAACTTGGTTTTGAATCCCCTTTTTGATCA
TTTGGCAATCATACACTTTACAAACATCAAGTTTGAATCTCGAATTTGCTCTGATCTTGTCCAACTGTACAAACCCTTATTGTACTCTAATATCAGATACGTTCGCGTTCTAGTTCAAGA
GATTGCACATCCCAGCAATGCAACTGTTGTTTCCTTGTCATTCACTCAATGTTTGGAGGAAAGGAGAGTTGGATATTGAACACGTAGGATTGACTAAAACTGTGATGTGAGCATTCACCT
AGTTGATCCATACAACAATGAGCACAAAGACCAAAAAATACAATACTGTTCAGTAAATTTGGCATCCATTCCATCAGATTGGCTGTTTGACATTCTTATTTAATATTATATTTTGCGTGA
ATACGGCTGTAATTTCCTTGACAAGTGTGGTTAAAACTCACTAGTTAAGATGTGTATAGTGTGGTTGCTAATTCCAATTTGTGGTCAAATATAATGATTGTTTTTTATAATCATACCTAG

TCACATTTGTGTGTCCGACGGAAATCATTGCTTTCAG
GTTTGTAGAGTGATGAATCAATTCATGTTGATGCAGTTGTACACCCATTTCAAATATGCATTATAGGGGTGTAGTAACCCTTG
AACTATTCAACATTGAATGTATTTGCTCTAGTGATCGCATTGAAGAGTTTAAAAAGATTGGTGTTGAGGTATGTACTAGTTTTGATTGTTGATTGCTTTATGACCGATATTAACATGAGT
GGGTTTGTTTAAATTGAATAGGTTGTTGCTGCTTCTGTCGACTCTCAATTTTCTCATCTTGCATGGACCAAGCAACCCCGTTTAGAAGGCGGCCTTGGCGATATGAAGATTCCCATTATT
GCTGATATCACCAAGACTATTTCCCGCGATTACGGTGTTTTGGTTGAAAGTGGATCTGATGCTGGTGTTGCTCTTCGTG
GTATGAGTTTTTATTAACATGGCTGCACATTTGAATAGTTT
TTCTGGTCAATCCATCAGTTTTTTAAATCTCATACTGACATGTATATCAATTGAATTCCAACAGGTACATTCATCATTGATCCACATCAGATTGTGCGTGTTGTGCAAATCAACGATCTT
CCTATTGGTCGCAGTGTCGATGAAGTTCTCCGTTTGATTGATGCTCTCCAGTTCCATGAAAAGCATGGAGATG
GTGAGTTTTGGCATGCTTTTGATTTGCTCTCAATCACAAGGTTTTAA
TAAGAGATACTATGATGGTGATTAGTTTGCCCCGTTGGATGGAAAAAAGGATCTCACTCGATGAAAGCCGATCCCATCGGCTCCAAAGCCTACTTTGAAAAGGTAAATCTGAATACTTTT
TTCATGGTTTCAGATTTTGATGAATTGATAGCAACAACTTGATCATGTTGATTGATACTTTCTTTATTCCAACTCGATGCCATATTCCACTTTACCTTTGCATTTACTACTTTCCCTGAA
CGCATCGTTTATCAAACTATCTAGATCAATTCCTAAATTAATCGGAACTATTTACAGGAATTTTCTCAGAGTGCTGGCAAACGAAAGAACAACGCAGACTCGACGTCACCAACAAAGCCA
GTTAAAAAGGCACATCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCAACGGTTCAACAAAAAGCTCCTTTTTTCACTGCCCAGGCTGTTGTCAATGGTGCATTCAAAGAAGTCACTCTCGATCAGTACAAGGGAAAATACCTTGTTTTATTCTTCTAT
CCTCTTGACT
TCACATTTGTGTGTCCGACGGAAATCATTGCTTTCAGTGATCGCATTGAAGAGTTTAAAAAGATTGGTGTTGAGGTTGTTGCTGCTTCTGTCGACTCTCAATTTTCTCAT
CTTGCATGGACCAAGCAACCCCGTTTAGAAGGCGGCCTTGGCGATATGAAGATTCCCATTATTGCTGATATCACCAAGACTATTTCCCGCGATTACGGTGTTTTGGTTGAAAGTGGATCT
GATGCTGGTGTTGCTCTTCGTG
GTACATTCATCATTGATCCACATCAGATTGTGCGTGTTGTGCAAATCAACGATCTTCCTATTGGTCGCAGTGTCGATGAAGTTCTCCGTTTGATTGAT
GCTCTCCAGTTCCATGAAAAGCATGGAGATG
TTTGCCCCGTTGGATGGAAAAAAGGATCTCACTCGATGAAAGCCGATCCCATCGGCTCCAAAGCCTACTTTGAAAAGGAATTTTCTCAG
AGTGCTGGCAAACGAAAGAACAACGCAGACTCGACGTCACCAACAAAGCCAGTTAAAAAGGCACATCAGTGA

Retrieve as FASTA