Entry information : BdeHalNPrx
Entry ID 6766
Creation 2009-05-07 (Christophe Dunand)
Last sequence changes 2009-05-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: BdeHalNPrx
Name BdeHalNPrx
Class No haem, no metal haloperoxidase    [Orthogroup: HalNPrx001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium
Organism Batrachochytrium dendrobatidis    [TaxId: 109871 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdeHalNPrx
start..stop
S start..stop
BcHalNPrx 53 0.00000002 25..295 3..267
PaerHalNPrx_PAO1 51 0.00000009 25..169 3..138
PfHalNPrx01_Pf5 49 0.0000007 25..169 3..138
GfoHalNPrx 46 0.000004 53..260 28..240
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 559136..559329 194 N° 2 559600..559868 269 N° 3 559963..560070 108 N° 4 560165..560354 190
N° 5 560425..560507 83 N° 6 560577..560650 74  
join(559136..559329,559600..559868,559963..560070,560165..560354,560425..560507, 560577..560650)


exon

Literature and cross-references BdeHalNPrx
DNA ref. JGI genome:   scaffold_9 (559136..560650)
mRNA ref. JGI transcript:   63371
Protein sequence: BdeHalNPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   305
PWM (Da):   %s   32885.81  
PI (pH):   %s   7.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPTTDSPQVTKDPSGKYFTIDNWVNNGQGTEIYTRTWVPEPQASASIVAVVLFVHGLGEHVQRYNNIFPAFAKAGIKVVAFDQRGFGRTGRRSGKLGNSEGLAAVFQDMKDLIASQGIPGVPLFLMGHSMGGGIVLSFSAKYPEGIKGIIAAPFIAPGTTTKPKGIEPFLLKFAPAIIPSFTIKSSVDPKLLCRDSAEVQAYIEDPYVHPWMTLGTTSSLVGMSADLITVHAPKCTLPIFINHGDGDPVTCPIASKKFYDDAPSKDKTYKSLGDRYHVHNGSPSERDEIISLWVDWILAHL

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCACCCACTACAGACTCTCCTCAAGTCACCAAGGACCCGTCAGGAAAGTACTTTACTATTGATAACTGGGTCAACAATGGTCAAGGAACAGAGATATACACTCGCACTTGGGTT
CCAGAACCTCAAGCCTCAGCCTCCATTGTAGCGGTTGTTCTCTTTGTACATGGTCTAGGTGAACATGTTCAGCG
GTAAGCAACTATTCCTGTTTTATTGGTTACAAATTGAATGAGTAAG
AGTCTTTTTCAATCATTTGGTCTATCCTTGAGTATATTACAATGCATGGCCTTTCCACCATGAATACAAAAGAAATTCAAAATCTGCCATAATTTGAATTATGCTTTCAACCTGGCACTG
CATCCAGTGATTTGCCATGAATCAGGATCCAGCTGTGCAGTGACGGTTGAATCCAGTTTATTACTGCGTATATCTACTGATTTCCAACTGTATTCTACAATTAGATACAATAATATTTTT
CCAGCATTTGCAAAAGCTGGTATTAAAGTTGTCGCCTTTGATCAGCGTGGATTTGGTCGTACTGGTCGTCGAAGTGGTAAACTTGGCAACAGCGAAGGCTTGGCTGCTGTCTTTCAAGAC
ATGAAGGATCTGATTGCATCTCAAGGCATACCAGGCGTTCCCTTATTTTTAATGGGCCATTCCATGGGAGGAGGCATTGTTTTAAGTTTCAGTGCCAAGTATCCAGAGGGGATCAAGGGT
ATAATTGCCAGTG
GTTAGTAAGAGGCTGTTGTATAACGTGTTTATTCATTGGTTGCTTGATACTTTATAATATTGCCATCAGCTAACCTTATACAACTATGTTTTAGCACCTTTTATTGC
TCCTGGAACAACTACCAAACCAAAGGGTATAGAACCGTTTTTGCTCAAGTTTGCTCCAGCTATAATCCCATCATTTACCATCAAAAGCTCAGTTG
GTAGGTCAACTGCACATCATTACAC
GTTGGAATCGTTTTATTATTTGTACAGAATATTGCTGGCTCATTTCTACTGCTGGATTGATGTAAATAGATCCCAAACTCCTTTGCAGAGATTCTGCAGAAGTTCAGGCGTACATTGAAG
ATCCATATGTTCATCCTTGGATGACTCTTGGCACAACTTCATCCCTAGTTGGTATGAGTGCAGATCTTATCACCGTACATGCTCCTAAGTGCACATTGCCAATTTTTATCAATCATGGAG
ATGGCGATCCCGTTACTTG
GTAAACAGTATTTGATTTAAGCTGCACTTGCATTCCCATGCCGAATATTTTCTGACGCTTGAATGTATAGCCCAATTGCATCCAAGAAATTCTATGATGAT
GCTCCCAGCAAAGATAAGACTTACAAGTCTTTAGGCGACCGTTACCATGAAG
GCAAGTGCTTGAATTAATATCTATTCATTGTATCGTGGTTGTATATAAACACTTTTATGTATTGATTA
GTACACAATGGGTCACCTTCAGAACGAGATGAGATTATCAGTTTGTGGGTTGATTGGATTCTTGCTCATCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCACCCACTACAGACTCTCCTCAAGTCACCAAGGACCCGTCAGGAAAGTACTTTACTATTGATAACTGGGTCAACAATGGTCAAGGAACAGAGATATACACTCGCACTTGGGTT
CCAGAACCTCAAGCCTCAGCCTCCATTGTAGCGGTTGTTCTCTTTGTACATGGTCTAGGTGAACATGTTCAGCG
ATACAATAATATTTTTCCAGCATTTGCAAAAGCTGGTATTAAAGTT
GTCGCCTTTGATCAGCGTGGATTTGGTCGTACTGGTCGTCGAAGTGGTAAACTTGGCAACAGCGAAGGCTTGGCTGCTGTCTTTCAAGACATGAAGGATCTGATTGCATCTCAAGGCATA
CCAGGCGTTCCCTTATTTTTAATGGGCCATTCCATGGGAGGAGGCATTGTTTTAAGTTTCAGTGCCAAGTATCCAGAGGGGATCAAGGGTATAATTGCCAGTG
CACCTTTTATTGCTCCT
GGAACAACTACCAAACCAAAGGGTATAGAACCGTTTTTGCTCAAGTTTGCTCCAGCTATAATCCCATCATTTACCATCAAAAGCTCAGTTG
ATCCCAAACTCCTTTGCAGAGATTCTGCA
GAAGTTCAGGCGTACATTGAAGATCCATATGTTCATCCTTGGATGACTCTTGGCACAACTTCATCCCTAGTTGGTATGAGTGCAGATCTTATCACCGTACATGCTCCTAAGTGCACATTG
CCAATTTTTATCAATCATGGAGATGGCGATCCCGTTACTTG
CCCAATTGCATCCAAGAAATTCTATGATGATGCTCCCAGCAAAGATAAGACTTACAAGTCTTTAGGCGACCGTTACCAT
GAAG
TACACAATGGGTCACCTTCAGAACGAGATGAGATTATCAGTTTGTGGGTTGATTGGATTCTTGCTCATCTTTAA

Retrieve as FASTA