Entry information : Bde1CysPrx
Entry ID 6769
Creation 2009-05-09 (Christophe Dunand)
Last sequence changes 2009-05-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Bde1CysPrx
Name Bde1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium
Organism Batrachochytrium dendrobatidis    [TaxId: 109871 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Bde1CysPrx
start..stop
S start..stop
Gve1CysPrx 291 2e-101 21..230 1..210
Gz1CysPrx 288 1e-99 21..232 7..218
Dh1CysPrx 286 7e-99 21..232 9..220
Ccin1CysPrx 283 5e-98 21..232 4..219
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2052..2229 178 N° 2 1774..1913 140 N° 3 1272..1652 381  
complement(join(1272..1652,1774..1913,2052..2229))


exon

Literature and cross-references Bde1CysPrx
DNA ref. JGI genome:   scaffold_100 (2229..1272)
mRNA ref. JGI transcript:   21125
Protein sequence: Bde1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   25438.1  
PI (pH):   %s   6.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTNPCISKATPASVAAAARGLRLGDTAPNFDAKTTQGQIEFHEFKKDSWAILFSHPEDFTPVCTTELGAVAKLSSEWAERNIKPIGLSCNTLDSHEAWIADINETNTTVKFPIIADADRSIATLYGMLDQQDSTNVDKLGMPLTVRSVFIIDPKHVVRLILTYPASTGRNFNEVLRVVDSLQLTEKRKVCTPVNWLPGQDVIIPPSVSQADADKLFPGHKIHKPYLRTTAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCAATCCCTGCATCTCCAAAGCTACCCCTGCCTCTGTTGCTGCCGCTGCTCGTGGCTTGCGTCTGGGCGATACAGCTCCCAACTTTGATGCCAAGACCACTCAGGGTCAGATTGAG
TTCCATGAATTCAAAAAGGATTCATGGGCCATTCTGTTCTCGCATCCAGAGGACTTTA
GTAAGTTTGAGATTACTGAGTTGTTTAAATGGCTGTAAATCCATTGGGTCGAATACAAGCTA
ATACCTTATCATCTCAATCCCAATCCTGGCTTCAACTGATTTTAACTTGATTCATCTACTCCTCTTGTATTGTCAGCCCCTGTCTGTACCACCGAGCTTGGTGCTGTTGCCAAGCTATCT
AGTGAATGGGCTGAACGCAACATCAAACCCATCGGTTTGTCTTGCAACACTCTAGACTCTCATGAAGCCTGGATTGCTGACATCAATGAAACCCAG
GTAAGCAAACTGTTGTCAACATAT
GCAGTATCAGATCTTGTGTGTAAGGAACCATGAGAACCTGATCTAGCAGCGAATTTTATGAAGTGTGTTCTGATCTATCTGACATTGATCAACTCAGAACACCACTGTCAAGTTTCCAAT
CATTGCTGATGCCGATCGTTCCATTGCCACTTTGTATGGCATGTTGGACCAGCAAGATTCTACCAATGTAGACAAGCTTGGTATGCCCTTGACTGTGAGATCTGTTTTTATTATCGATCC
CAAGCACGTTGTCCGACTCATCTTGACCTATCCTGCATCCACTGGTCGCAACTTCAACGAGGTTCTGCGTGTCGTTGATTCTCTCCAGCTTACCGAGAAGCGCAAGGTCTGTACCCCTGT
CAACTGGCTGCCTGGTCAGGATGTGATTATTCCTCCTTCTGTCAGCCAGGCTGATGCTGACAAGCTATTTCCTGGTCACAAGATCCACAAGCCATACCTCCGTACTACTGCTCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCAATCCCTGCATCTCCAAAGCTACCCCTGCCTCTGTTGCTGCCGCTGCTCGTGGCTTGCGTCTGGGCGATACAGCTCCCAACTTTGATGCCAAGACCACTCAGGGTCAGATTGAG
TTCCATGAATTCAAAAAGGATTCATGGGCCATTCTGTTCTCGCATCCAGAGGACTTTA
CCCCTGTCTGTACCACCGAGCTTGGTGCTGTTGCCAAGCTATCTAGTGAATGGGCTGAACGC
AACATCAAACCCATCGGTTTGTCTTGCAACACTCTAGACTCTCATGAAGCCTGGATTGCTGACATCAATGAAACCCAG
AACACCACTGTCAAGTTTCCAATCATTGCTGATGCCGATCGT
TCCATTGCCACTTTGTATGGCATGTTGGACCAGCAAGATTCTACCAATGTAGACAAGCTTGGTATGCCCTTGACTGTGAGATCTGTTTTTATTATCGATCCCAAGCACGTTGTCCGACTC
ATCTTGACCTATCCTGCATCCACTGGTCGCAACTTCAACGAGGTTCTGCGTGTCGTTGATTCTCTCCAGCTTACCGAGAAGCGCAAGGTCTGTACCCCTGTCAACTGGCTGCCTGGTCAG
GATGTGATTATTCCTCCTTCTGTCAGCCAGGCTGATGCTGACAAGCTATTTCCTGGTCACAAGATCCACAAGCCATACCTCCGTACTACTGCTCTCTAA

Retrieve as FASTA