Entry information : LbiHalPrx05
Entry ID 6776
Creation 2009-05-10 (Christophe Dunand)
Last sequence changes 2009-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiHalPrx05
Name LbiHalPrx05
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiHalPrx05
start..stop
S start..stop
AbHalPrx03_bisporus 499 4e-178 14..385 5..371
AbHalPrx04_bisporus 493 4e-176 14..386 5..373
AbHalPrx05_bisporus 422 7e-148 30..386 20..371
AdelHalPrx01 405 4e-141 9..384 3..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3729582..3729633 52 N° 2 3729090..3729340 251 N° 3 3728969..3729026 58 N° 4 3728750..3728920 171
N° 5 3728673..3728693 21 N° 6 3728571..3728623 53 N° 7 3727968..3728519 552  
complement(join(3727968..3728519,3728571..3728623,3728673..3728693,3728750..3728 920,3728969..3729026,3729090..3729340,3729582..3729633))


exon

Literature and cross-references LbiHalPrx05
DNA ref. JGI genome:   LG_10 (3729633..3727968)
EST ref. GenBank:   EX804240.1 [3' end]
Protein sequence: LbiHalPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   386
PWM (Da):   %s   41651.9 Transmb domain:   %s   i9-31o
PI (pH):   %s   5.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTRKVNCILYLLRVNFASIALALSSTTVLAFPSYGSLAGLSEAELDRIIPLLEARNAGPPPGPLKNTSTKLVNDKNHPWKPLGYGDIRGPCPGLNTLASHWLPRNGIATPAQIVNAVQEGFNMGNDLAVFVTYAAHLVDGNQVTDLLSIGGKTPQTGPDPPAPAIVGGLNTHAVFEGDASMTRGDAFFGDNHSFNETQFDEFSAFSNKFGGGYYNLSVAAEFRWQRIQESIATNPNFSLISPRYFTAYAESVFPLVFFVDGRVSDGRLSLPNARGFFQNSQMPKDFFRPNQSIGLNEIGDGISAIASAHPIAPGKNEGVGNYVLDPTSADFDHFCLLYINFVNQTVKSLYPNPKGVLLDALKRNLNNFYGPLNGSDCEQIFPYG

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 1 EST (short 3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCCGAAAGGTCAACTGCATTTTATATCTCCTGCGTGTTAACTTCGCTTGTAAGTCGTCGACGCTATGAAAAAACTACGGATCGAGTCATTGACGGGCTGGCAAGTTTCCTGCCACT
GCGGAAGCTGAAAGCACCGCATCGCCTTTTAAAGTCGATGTGACCTTAGCCCAGCTGCCCCTGGTCATTCACAGCATTCTGAGATCATTGTCACGAGTATAAGATAGGTGTGTGTAGGCG
TCGAATTCCAACAATTCAGTCGTGCATAATGGCTCGCCTTACTTTCCTCGCAGCTATTGCCCTGGCATTATCTTCCACCACTGTACTAGCATTCCCATCATACGGCTCCCTTGCTGGGCT
TTCAGAGGCGGAATTAGACCGTATTATTCCCTTGCTAGAAGCTCGTAACGCTGGCCCTCCTCCTGGACCACTGAAGAATACTTCAACAAAATTGGTCAACGACAAGAACCACCCCTGGAA
GCCTCTCGGATATGGCGATATTCGAGGTCCTTGCCCTGGGTTAAACACACTGGCCTCCCATGGG
GTGAGTTCGGACATTTATGGTTACGTTTCATCGGAGTTAATTGTAACTGTTTTATT
CGTGCAGTGGCTTCCTCGAAACGGCATCGCTACTCCGGCGCAAATTGTCAACGCGGTGCAGGAAGGTCTGCTGTTCGACTAATTGCTGACAATTGATATTGATTGTTGCTTAGGATTCAA
TATGGGAAATGATTTGGCGGTCTTCGTCACATACGCTGCGCATCTCGTTGACGGCAATCAGGTCACGGACTTGCTTAGCATCGGTGGAAAGACGCCTCAAACAGGCCCTGACCCGCCCGC
GCCTGCCATTGTCGGTGGTCTCAATACGCACGCCGTATTTGAAG
GTATGTAATCACGATTTGTCGACTCTGGAGACCTTCTGACATCTATTTGATTGAAGGTGATGCAAGTATGACTCGA
G
GTATGATCATCGCCCCGATAATTAGATGACAATTGAACCGAGCCCTTAGGAGACGCATTTTTCGGAGATAACCACAGCTTTAACGAAACACAGTTTGATGAAGTGAGATATTTCTACGC
TTGCAGTCAGTGAAAGATTAATTTCTCCTCACAGTTTTCTGCCTTCAGCAACAAATTCGGCGGGGGATACTACAATTTGAGCGTAGCAGCCGAGTTTAGATGGCAGCGCATTCAAGAATC
TATTGCGACGAACCCAAACTTTTCTCTCATCTCCCCCCGTTACTTCACGGCGTATGCCGAGTCCGTGTTTCCCCTGGTATTCTTCGTCGACGGCCGCGTATCAGACGGACGGCTTAGCCT
ACCGAACGCGCGTGGGTTCTTCCAGAATAGCCAAATGCCCAAAGACTTCTTCCGGCCCAATCAGTCTATCGGCCTCAACGAAATTGGTGATGGGATTAGCGCTATTGCTAGTGCCCACCC
TATTGCGCCGGGAAAGAACGAGGGAGTTGGGAACTATGTCCTCGACCCTACATCTGCGGATTTCGACCATTTCTGCTTGCTTTACATCAACTTCGTCAACCAGACCGTAAAGTCACTCTA
CCCCAATCCCAAAGGCGTTTTGCTCGATGCCTTGAAGAGGAATCTCAACAATTTCTACGGCCCACTCAACGGGTCGGATTGTGAGCAGATCTTCCCTTATGGAAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCCGAAAGGTCAACTGCATTTTATATCTCCTGCGTGTTAACTTCGCTTCTATTGCCCTGGCATTATCTTCCACCACTGTACTAGCATTCCCATCATACGGCTCCCTTGCTGGGCTT
TCAGAGGCGGAATTAGACCGTATTATTCCCTTGCTAGAAGCTCGTAACGCTGGCCCTCCTCCTGGACCACTGAAGAATACTTCAACAAAATTGGTCAACGACAAGAACCACCCCTGGAAG
CCTCTCGGATATGGCGATATTCGAGGTCCTTGCCCTGGGTTAAACACACTGGCCTCCCATGGG
TGGCTTCCTCGAAACGGCATCGCTACTCCGGCGCAAATTGTCAACGCGGTGCAGGAA
G
GATTCAATATGGGAAATGATTTGGCGGTCTTCGTCACATACGCTGCGCATCTCGTTGACGGCAATCAGGTCACGGACTTGCTTAGCATCGGTGGAAAGACGCCTCAAACAGGCCCTGAC
CCGCCCGCGCCTGCCATTGTCGGTGGTCTCAATACGCACGCCGTATTTGAAG
GTGATGCAAGTATGACTCGAGGAGACGCATTTTTCGGAGATAACCACAGCTTTAACGAAACACAGTTT
GATGAA
TTTTCTGCCTTCAGCAACAAATTCGGCGGGGGATACTACAATTTGAGCGTAGCAGCCGAGTTTAGATGGCAGCGCATTCAAGAATCTATTGCGACGAACCCAAACTTTTCTCTC
ATCTCCCCCCGTTACTTCACGGCGTATGCCGAGTCCGTGTTTCCCCTGGTATTCTTCGTCGACGGCCGCGTATCAGACGGACGGCTTAGCCTACCGAACGCGCGTGGGTTCTTCCAGAAT
AGCCAAATGCCCAAAGACTTCTTCCGGCCCAATCAGTCTATCGGCCTCAACGAAATTGGTGATGGGATTAGCGCTATTGCTAGTGCCCACCCTATTGCGCCGGGAAAGAACGAGGGAGTT
GGGAACTATGTCCTCGACCCTACATCTGCGGATTTCGACCATTTCTGCTTGCTTTACATCAACTTCGTCAACCAGACCGTAAAGTCACTCTACCCCAATCCCAAAGGCGTTTTGCTCGAT
GCCTTGAAGAGGAATCTCAACAATTTCTACGGCCCACTCAACGGGTCGGATTGTGAGCAGATCTTCCCTTATGGAAAG

Retrieve as FASTA