Entry information : PgrDyPrx01
Entry ID 6777
Creation 2009-05-11 (Christophe Dunand)
Last sequence changes 2009-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PgrDyPrx01
Name PgrDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Puccinia graminis f. sp. tritici    [TaxId: 56615 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgrDyPrx01
start..stop
S start..stop
PgrDyPrx08 1036 0 1..509 1..509
PgrDyPrx03 734 0 19..503 34..519
PgrDyPrx06 733 0 19..503 21..506
PgrDyPrx05 699 0 19..506 34..522
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 123592..123646 55 N° 2 123935..124530 596 N° 3 124647..124941 295 N° 4 125041..125155 115
N° 5 125242..125330 89 N° 6 125434..125546 113 N° 7 125666..125788 123 N° 8 125869..125936 68
N° 9 126029..126104 76  
join(123592..123646,123935..124530,124647..124941,125041..125155,125242..125330, 125434..125546,125666..125788,125869..125936,126029..126104)


exon

Literature and cross-references PgrDyPrx01
DNA ref. JGI genome:   supercontig_2_40 (123592..126104)
Protein sequence: PgrDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   509 (488)
PWM (Da):   %s   55919.28 (53547.0)  
PI (pH):   %s   9.42 (9.27) Peptide Signal:   %s   cut: 22 range:22-509
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSNKLVWFLSLSVLRALVDLKNIQGDIIIGLQKRVEAFWFCTLKSESNSVEGFRRNLKDSLLPLITTTQDVLDTQKKINDHKRNKRSEGGNDLLPITQVNLGFSFAGLKKLGLKLEEIPTGGDGVFSKGQKVDAVDNLGDPVDPKTKKLKTWSKDFLHEANSIDFVILITAPDCKLLDQKLDQLRKNLSGFLASSFVRKGNVRPGNEVGHEHFGFDGISTPTIENINAQPGDKKSGIVKPDVVLLGQPASGGNTNNLDPKQAWIKDGSFMAFRELQQLVPEFQSFCDESAKKLQNPNVSGDFIGARIVGRWKSGAPLTLTPVQDKPELNRAQDFDYSDELKQERCPYAAHIRKTNPRNGIAGADPNTAVLPHLMIRNGIPGPELTAEEKKAKKTKENRGLLFVSYQSQIESGFQFVQLWCNNTDFPAKTPAKVTPGFDLLIGQTADEKPRVAQNINPLGIAGTTDPNNIVTAPAHFIVPLGGEYFLMPSIKAINEKLGLSSRSDL

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTAACAAGTTGGTCTGGTTTCTTTCTCTTTCTGTTCTCCGGGCCCTTGGTAGTTGCTGCTTCTCGCCAGTTTGTCTCGTATCAAACCTCTAGCTTTGCCAGCGATTTGTCTGG
GGTGAATGAACTACTTATGTGTTGGGCGGCGCTCGTATTAAGACTGTGTATAACTTATCGAGCTGGTATCGTCTACATATATGTAGTAGAACCCTATTTTCTTGATCTTTTGATGGCTCT
GCTTGCATCATGATTTGAAAAGCTCGAAGATAAACTAACTGACCGTTTGTTCTCTTCATACCCGTTCCGTTGACTTCCAACGTTACTCAACTGCTTTCCAGAGTTGACCTCAAGAACATC
CAAGGCGATATCATTATCGGTTTACAGAAACGAGTTGAAGCCTTCTGGTTTTGCACCCTAAAATCTGAATCCAACTCTGTCGAAGGTTTTCGTAGAAACCTGAAAGACTCTTTACTTCCG
TTGATTACCACCACTCAAGACGTGCTCGACACACAAAAAAAGATCAATGATCATAAACGAAATAAGAGATCCGAGGGGGGGAACGACCTGTTACCCATCACCCAGGTCAACCTCGGATTC
AGCTTTGCCGGATTGAAAAAATTGGGACTTAAGCTGGAAGAGATCCCAACCGGTGGCGACGGAGTCTTTTCGAAGGGCCAAAAGGTTGATGCGGTCGATAACTTGGGAGACCCCGTCGAC
CCAAAGACGAAAAAGTTGAAGACCTGGTCTAAAGACTTTTTGCATGAAGCCAACTCGATCGATTTCGTCATCTTGATCACGGCTCCGGACTGCAAGTTGTTGGATCAAAAACTAGACCAG
CTTCGAAAGAATTTGAGCGGGTTTTTGGCCTCTTCGTTTGTTCGCAAGGGTAATGTTAGACCCGGTAATGAGGTCGGGCATGAGCACTTTGGGTTCTTA
GTTGAGTGTCTTTCCTGCTTT
TTTTACCCTCATGAGTTTTGATATTTTCCACGAGCGGCAAATTGAGTCAATCAACCAATTACTTATACTGATGATGAACAAACCAATCTTAAAAGGACGGGATTTCCACGCCAACAATCG
AAAACATTAATGCCCAGCCAGGTGATAAGAAGAGTGGAATAGTTAAACCAGATGTGGTTTTACTCGGCCAACCTGCTTCGGGTGGGAATACCAATAACTTGGATCCGAAGCAGGCTTGGA
TTAAAGATGGCTCGTTTATGGCTTTCAGAGAGCTCCAACAACTCGTACCAGAGTTCCAATCCTTCTGCGACGAGTCTGCCAAAAAGCTTCAAAACCCTAATGTGTCTGGCGACTTCATCG
GGGCTAGAATTGTTGGCAGATGGAAATCAG
GTGAGCGCTTTCACCTCGTCTTTCCATTTTCAACTCAAGAAACACGAAGAATGTTTAGCGCTTCTTTATTGAATAACCTCCATCCTTGTC
TTGTTTTAGGTGCCCCACTTACCTTGACCCCAGTCCAAGATAAACCGGAACTGAATCGAGCACAGGACTTCGACTATTCCGATGAATTGAAACAAGAACGTTGTCCCTACGCTGCTCACA
TAAG
GTATCGGCTCAAATTTATGAACCAAAAGGATACCAAGTCCAATTGTAATTGAAATTATTATTATTATTTTTTTTGCTGTCTCCTAGAAAAACTAACCCGCGTAATGGCATAGCTGG
TGCGGATCCCAACACGGCCGTCTTGCCTCATCTTATGATCAGAAACGGCATCCCTTATG
GTAAGTCCTGGGACAGCTCTTGGAATTGCATTTATCTCCATGTTTGGATTTTGATTTCGCA
TGGCCTGAAGAGGATTGACCATGGATGTGTTGCATTCATTAGGGCCTGAGCTTACCGCGGAAGAAAAGAAAGCGAAGAAAACGAAAGAGAATCGTGGTCTATTATTTGTTTCTTATCAAA
GCCAAATCGAAAGTGGATTCCAATTTGTTCAGAAG
GTAACTAACCGTTCACTTAAGTCGCTCTTTGAATCTTGATTTTTTTTTTTGAAAAGGACTGACATCAGATGAAACTTCTGACTCT
TTGTTGCCTCAATCGATTTTTTCGATCATCACAGCTTTGGTGCAACAACACCGATTTTCCGGCTAAAACTCCGGCTAAAGTGACTCCCGGGTTCGATTTGTTAATCGGACAAACCGCTGA
TGAAAAGCCTCGAGTAGCTCAAAATATCAACCCATTG
GTGAGGACGATATCATAGTTCAATGGCTCAATGGAGGTCTGACAAATCGAGCCCTGTTTTGTGCATGTTTCGTTTGACAGGGA
ATTGCGGGCACTACCGATCCCAACAACATAGTGACCGCCCCGGCACATTTCATCGTTCCCCTTGG
GTGAGTATCGGCTGCATTCTCAGAGAGTAGGAAATGAGACTAAACCTAAACATGA
CCTTTTACGTTACGTTATCCCATCTTTTGTACCCCAGTGGAGAATATTTCCTTATGCCTTCCATCAAAGCCATCAACGAAAAGCTTGGCCTTTCGTCAAGATCTGACCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTAACAAGTTGGTCTGGTTTCTTTCTCTTTCTGTTCTCCGGGCCCTTGTTGACCTCAAGAACATCCAAGGCGATATCATTATCGGTTTACAGAAACGAGTTGAAGCCTTCTGG
TTTTGCACCCTAAAATCTGAATCCAACTCTGTCGAAGGTTTTCGTAGAAACCTGAAAGACTCTTTACTTCCGTTGATTACCACCACTCAAGACGTGCTCGACACACAAAAAAAGATCAAT
GATCATAAACGAAATAAGAGATCCGAGGGGGGGAACGACCTGTTACCCATCACCCAGGTCAACCTCGGATTCAGCTTTGCCGGATTGAAAAAATTGGGACTTAAGCTGGAAGAGATCCCA
ACCGGTGGCGACGGAGTCTTTTCGAAGGGCCAAAAGGTTGATGCGGTCGATAACTTGGGAGACCCCGTCGACCCAAAGACGAAAAAGTTGAAGACCTGGTCTAAAGACTTTTTGCATGAA
GCCAACTCGATCGATTTCGTCATCTTGATCACGGCTCCGGACTGCAAGTTGTTGGATCAAAAACTAGACCAGCTTCGAAAGAATTTGAGCGGGTTTTTGGCCTCTTCGTTTGTTCGCAAG
GGTAATGTTAGACCCGGTAATGAGGTCGGGCATGAGCACTTTGGGTTCTTA
GACGGGATTTCCACGCCAACAATCGAAAACATTAATGCCCAGCCAGGTGATAAGAAGAGTGGAATAGTT
AAACCAGATGTGGTTTTACTCGGCCAACCTGCTTCGGGTGGGAATACCAATAACTTGGATCCGAAGCAGGCTTGGATTAAAGATGGCTCGTTTATGGCTTTCAGAGAGCTCCAACAACTC
GTACCAGAGTTCCAATCCTTCTGCGACGAGTCTGCCAAAAAGCTTCAAAACCCTAATGTGTCTGGCGACTTCATCGGGGCTAGAATTGTTGGCAGATGGAAATCAG
GTGCCCCACTTACC
TTGACCCCAGTCCAAGATAAACCGGAACTGAATCGAGCACAGGACTTCGACTATTCCGATGAATTGAAACAAGAACGTTGTCCCTACGCTGCTCACATAAG
AAAAACTAACCCGCGTAAT
GGCATAGCTGGTGCGGATCCCAACACGGCCGTCTTGCCTCATCTTATGATCAGAAACGGCATCCCTTATG
GGCCTGAGCTTACCGCGGAAGAAAAGAAAGCGAAGAAAACGAAAGAGAAT
CGTGGTCTATTATTTGTTTCTTATCAAAGCCAAATCGAAAGTGGATTCCAATTTGTTCAGAAG
CTTTGGTGCAACAACACCGATTTTCCGGCTAAAACTCCGGCTAAAGTGACTCCCGGG
TTCGATTTGTTAATCGGACAAACCGCTGATGAAAAGCCTCGAGTAGCTCAAAATATCAACCCATTG
GGAATTGCGGGCACTACCGATCCCAACAACATAGTGACCGCCCCGGCACATTTC
ATCGTTCCCCTTGG
TGGAGAATATTTCCTTATGCCTTCCATCAAAGCCATCAACGAAAAGCTTGGCCTTTCGTCAAGATCTGACCTATGA

Retrieve as FASTA