Entry information : FoCIIAA
Entry ID 6801
Creation 2009-05-18 (Christophe Dunand)
Last sequence changes 2009-05-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: FoCIIAA
Name FoCIIAA
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Fusarium
Organism Fusarium oxysporum    [TaxId: 5507 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FoCIIAA
start..stop
S start..stop
GmoCIIAA 840 0 1..510 1..510
GzCIIAA01 766 0 1..510 1..539
NhaeCIIAA 593 0 122..503 106..486
CfioCIIAA01_MH18 427 1e-147 98..488 15..402
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 738450..739703 1254 N° 2 739757..740035 279  
join(738450..739703,739757..740035)


exon

Literature and cross-references FoCIIAA
DNA ref. JGI genome:   Supercontig_2.13 (738450..740035)
Protein sequence: FoCIIAA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   510 (489)
PWM (Da):   %s   54974.81 (52953.7)  
PI (pH):   %s   8.06 (8.06) Peptide Signal:   %s   cut: 22 range:22-510
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKFTVLIAAALAAAPIPEAAAHPGMGETIKEIERIAARSWGSGWGGNKWPGQGNGGGSSSWPGQNNGGSSSSWPGQSNGNGDGSSSWPGQTNSGGSSSWPGQSSGGSGSGSGNGNGNGWSGDSFDAHSLIGDLVTISDKSLTSVGRDIKKILQGNGNPTSRERYFGCPSMNSQRCKRDTCCVWQYISNELEDKFRGEAGRCTRWARYAVRIGFHDAGTWSLKTASQGGGADGSIILSNELTRGENMGLQQIGEYYQTIYNKYHTQYGFTQVTMADLIQMGSNIAAVTCPLGPRVRSFVGRKDSTKANLGGLLPRVDSDALTLINLFKDKTIGPDDLVALIGAHTTSQQHHTNIDRDGDPQDSTPGVWDILFYQQTIDQNAPKRVYKFPSDVALANHPLTQPAFEAFASGSTGQAAWNVDYARAYVRLSLLGVNNINDLTECTKVLPQPVESYRHKDKGRFNKWLQTDDNSWTSKSVSKDVDDGYEISVPENKIPSRRGPWKTWTSTFKWW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 7, 1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTTACCGTCCTTATTGCAGCTGCTCTGGCTGCTGCGCCTATCCCAGAGGCTGCTGCTCACCCTGGCATGGGAGAGACCATCAAGGAGATCGAACGAATTGCTGCTCGTAGCTGG
GGCAGTGGATGGGGTGGAAACAAGTGGCCAGGACAAGGCAACGGCGGCGGTTCAAGCTCGTGGCCTGGTCAGAATAATGGAGGAAGCTCTAGCTCTTGGCCTGGACAAAGCAATGGCAAT
GGAGATGGTTCCAGTTCTTGGCCTGGACAGACCAACAGTGGCGGTTCAAGCTCCTGGCCCGGCCAGAGCAGCGGAGGTAGTGGCAGTGGCAGTGGCAATGGTAACGGCAATGGCTGGTCC
GGAGACAGCTTTGATGCCCACTCCCTCATTGGCGACCTTGTCACCATCAGTGACAAGTCACTCACTTCAGTCGGCAGAGACATCAAGAAGATCCTTCAAGGCAACGGCAACCCCACCAGC
CGCGAGCGCTATTTTGGCTGCCCTTCCATGAACTCTCAACGTTGCAAGCGTGATACCTGCTGTGTTTGGCAGTACATCTCCAACGAACTCGAGGACAAGTTCAGGGGTGAGGCAGGCCGT
TGCACGCGATGGGCTCGATATGCTGTACGCATTGGCTTCCACGATGCCGGTACCTGGTCTCTCAAGACCGCTTCCCAAGGCGGTGGTGCTGATGGCTCCATCATTCTCTCCAACGAGCTC
ACCCGTGGCGAGAACATGGGTCTTCAGCAGATTGGCGAGTACTACCAGACCATCTACAACAAGTACCACACTCAGTATGGTTTCACTCAGGTCACCATGGCTGATCTGATCCAAATGGGC
TCCAACATTGCTGCCGTTACCTGCCCTCTCGGTCCCCGTGTTCGCTCTTTCGTTGGACGCAAGGATAGCACGAAAGCCAACCTCGGCGGTCTTCTGCCTCGCGTTGACTCTGATGCTCTC
ACTCTGATTAACCTCTTCAAGGACAAGACAATTGGCCCCGATGACCTTGTTGCCCTTATCGGCGCGCACACAACCTCTCAGCAGCATCACACCAACATTGATCGTGATGGTGACCCTCAG
GACAGCACTCCTGGTGTCTGGGATATTCTCTTCTACCAGCAAACCATTGATCAGAATGCCCCCAAGCGTGTCTACAAGTTCCCTAGTGATGTGGCTCTCGCCAACCATCCACTCACTCAG
CCTGCTTTTGAGGCCTTTGCCAGCGGCAGCACTGGTCAGGCCGCTTGGAACGTG
GTAAGTTTCGCCAGCCCCAAACATATTAAGAACGTTTTATTAACCAGATCTAGGACTATGCCCGTG
CCTATGTCCGTCTCAGTCTTCTAGGTGTTAACAACATCAACGACCTTACCGAGTGCACAAAGGTCCTCCCTCAACCCGTCGAGTCCTACCGCCACAAGGACAAGGGCCGATTCAACAAGT
GGCTCCAGACCGATGATAACTCGTGGACCTCCAAGAGTGTCTCCAAGGATGTCGACGATGGTTACGAGATCTCTGTCCCTGAGAACAAGATTCCCTCCAGGCGTGGTCCTTGGAAGACAT
GGACCAGCACATTCAAGTGGTGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTTACCGTCCTTATTGCAGCTGCTCTGGCTGCTGCGCCTATCCCAGAGGCTGCTGCTCACCCTGGCATGGGAGAGACCATCAAGGAGATCGAACGAATTGCTGCTCGTAGCTGG
GGCAGTGGATGGGGTGGAAACAAGTGGCCAGGACAAGGCAACGGCGGCGGTTCAAGCTCGTGGCCTGGTCAGAATAATGGAGGAAGCTCTAGCTCTTGGCCTGGACAAAGCAATGGCAAT
GGAGATGGTTCCAGTTCTTGGCCTGGACAGACCAACAGTGGCGGTTCAAGCTCCTGGCCCGGCCAGAGCAGCGGAGGTAGTGGCAGTGGCAGTGGCAATGGTAACGGCAATGGCTGGTCC
GGAGACAGCTTTGATGCCCACTCCCTCATTGGCGACCTTGTCACCATCAGTGACAAGTCACTCACTTCAGTCGGCAGAGACATCAAGAAGATCCTTCAAGGCAACGGCAACCCCACCAGC
CGCGAGCGCTATTTTGGCTGCCCTTCCATGAACTCTCAACGTTGCAAGCGTGATACCTGCTGTGTTTGGCAGTACATCTCCAACGAACTCGAGGACAAGTTCAGGGGTGAGGCAGGCCGT
TGCACGCGATGGGCTCGATATGCTGTACGCATTGGCTTCCACGATGCCGGTACCTGGTCTCTCAAGACCGCTTCCCAAGGCGGTGGTGCTGATGGCTCCATCATTCTCTCCAACGAGCTC
ACCCGTGGCGAGAACATGGGTCTTCAGCAGATTGGCGAGTACTACCAGACCATCTACAACAAGTACCACACTCAGTATGGTTTCACTCAGGTCACCATGGCTGATCTGATCCAAATGGGC
TCCAACATTGCTGCCGTTACCTGCCCTCTCGGTCCCCGTGTTCGCTCTTTCGTTGGACGCAAGGATAGCACGAAAGCCAACCTCGGCGGTCTTCTGCCTCGCGTTGACTCTGATGCTCTC
ACTCTGATTAACCTCTTCAAGGACAAGACAATTGGCCCCGATGACCTTGTTGCCCTTATCGGCGCGCACACAACCTCTCAGCAGCATCACACCAACATTGATCGTGATGGTGACCCTCAG
GACAGCACTCCTGGTGTCTGGGATATTCTCTTCTACCAGCAAACCATTGATCAGAATGCCCCCAAGCGTGTCTACAAGTTCCCTAGTGATGTGGCTCTCGCCAACCATCCACTCACTCAG
CCTGCTTTTGAGGCCTTTGCCAGCGGCAGCACTGGTCAGGCCGCTTGGAACGTG
GACTATGCCCGTGCCTATGTCCGTCTCAGTCTTCTAGGTGTTAACAACATCAACGACCTTACCGAG
TGCACAAAGGTCCTCCCTCAACCCGTCGAGTCCTACCGCCACAAGGACAAGGGCCGATTCAACAAGTGGCTCCAGACCGATGATAACTCGTGGACCTCCAAGAGTGTCTCCAAGGATGTC
GACGATGGTTACGAGATCTCTGTCCCTGAGAACAAGATTCCCTCCAGGCGTGGTCCTTGGAAGACATGGACCAGCACATTCAAGTGGTGGTAA

Retrieve as FASTA