Entry information : GmoCIIAA
Entry ID 6806
Creation 2009-05-18 (Christophe Dunand)
Last sequence changes 2017-05-03 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-03 (Catherine Mathe)
Peroxidase information: GmoCIIAA
Name GmoCIIAA
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella moniliformis (Fusarium verticillioides)    [TaxId: 117187 ]
Cellular localisation N/D
Tissue type Conidia
Inducer Infected host
Repressor N/D
Best BLASTp hits
Perox score E-value GmoCIIAA
start..stop
S start..stop
FoCIIAA 875 0 1..510 1..510
GzCIIAA01 770 0 1..510 1..539
NhaeCIIAA 594 0 122..503 106..486
CfioCIIAA01_MH18 429 4e-148 122..488 38..402
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 759138..760391 1254 N° 2 758806..759084 279  
complement(join(758806..759084,759138..760391))


exon

Literature and cross-references GmoCIIAA
DNA ref. GenBank:   AAIM02000117.1 (437162..435580) JGI genome:   Scaffold_12 (760391..758806)
EST ref. GenBank:   DR619650 [3' end]
Cluster/Prediction ref. JGI gene:   4442
Protein sequence: GmoCIIAA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   510 (489)
PWM (Da):   %s   54667.62 (52646.5)  
PI (pH):   %s   8.06 (8.06) Peptide Signal:   %s   cut: 22 range:22-510
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKFTVLIAAALAAAPIPEAAAHPGMGETIKEIERIAARSWGSGWGGNKWPGQGNGGGSSSWPGQSNGNGGGSSSWPGQTNSGGSSSWPGQSSGNGGGSSSWPGQSNGGSGSGSNSGSGWSGDSFDAHSLIGDLATLSDKSLTSVGSDIKKILQGNGNPTSRERYFGCPSMNSQRCKRDTCCVWQYISNELEDKFRGEAGRCTRWARYAVRIGFHDAGTWSLKTASQGGGADGSIILSNELTRGENMGLQQIGEYYQTIYDKYHTQYGFTQVTMADLIQMGSNIAAVTCPLGPRVRSFVGRKDSTKANPGGLLPSVKSDALTLINLFKDKTIGPDDLVALIGAHTTSQQHHTNIDRDGDPQDSTPGVWDILFYQQTIDQDAPKRVYKFPSDVALANHPLTQPAFEAFASGSTGQAAWNVDYARAYVRLSLLGVNNINSLTECTKVLPQPVESYRHKDKGRFNKWLQTDDNSWTSKSVSKDVDDGYEISVPENKIPSRRGPWKTWTSTFKWW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 1 intron) and 2 ESTs. Longer C-Term.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTTACTGTCCTCATTGCAGCTGCTCTGGCTGCTGCGCCTATCCCAGAGGCTGCTGCTCACCCTGGCATGGGAGAGACCATCAAGGAGATCGAACGAATTGCTGCTCGTAGCTGG
GGCAGCGGATGGGGTGGAAACAAGTGGCCAGGACAAGGCAACGGCGGCGGTTCGAGCTCGTGGCCTGGTCAGAGTAACGGCAATGGAGGCGGTTCCAGTTCTTGGCCTGGACAGACCAAC
AGTGGCGGTTCAAGCTCTTGGCCAGGACAGAGCAGTGGAAACGGAGGAGGATCTAGCTCATGGCCCGGCCAGAGCAACGGAGGTAGTGGCAGCGGCAGCAACAGCGGCAGTGGCTGGTCC
GGAGACAGCTTTGATGCCCACTCCCTCATCGGCGACCTTGCCACCCTCAGCGACAAGTCCCTCACTTCAGTCGGCAGTGACATCAAGAAGATCCTTCAAGGCAACGGCAACCCCACCAGC
CGCGAGCGCTACTTCGGCTGCCCTTCCATGAACTCTCAACGTTGCAAGCGTGATACCTGCTGTGTCTGGCAGTACATTTCCAACGAGCTGGAGGACAAGTTCAGGGGCGAGGCTGGCCGC
TGCACAAGATGGGCTCGATATGCTGTCCGCATCGGCTTTCACGATGCCGGCACCTGGTCTCTCAAGACCGCTTCCCAAGGCGGCGGTGCTGATGGCTCCATCATTCTCTCGAACGAGCTC
ACTCGTGGCGAGAACATGGGTCTTCAGCAGATTGGCGAGTACTACCAGACCATCTACGACAAGTACCACACACAGTATGGCTTCACCCAGGTCACCATGGCTGATCTGATCCAAATGGGC
TCCAATATTGCTGCCGTTACCTGCCCTCTCGGTCCCCGTGTCCGCTCTTTCGTTGGACGCAAGGATAGCACCAAGGCCAACCCCGGCGGTCTCCTGCCTAGCGTTAAATCTGATGCTCTC
ACTCTGATCAACCTCTTCAAGGACAAGACAATTGGCCCCGATGACCTTGTTGCCCTGATCGGTGCGCACACAACCTCTCAGCAGCATCACACCAACATTGATCGTGATGGCGACCCTCAG
GACAGTACTCCTGGTGTCTGGGATATCCTCTTCTACCAGCAAACCATTGATCAGGACGCACCCAAGCGTGTCTACAAGTTCCCCAGTGATGTGGCCCTCGCCAACCATCCTCTTACCCAG
CCTGCCTTTGAGGCCTTTGCCAGCGGCAGCACTGGCCAAGCTGCCTGGAATGTG
GTAAGTCCCATTCAAAAGCATATCGTGAAACATATGTACTGACGTTTCCCCAGGACTATGCACGCG
CCTATGTCCGTCTCAGTCTCTTGGGTGTCAACAATATCAACAGCCTCACCGAGTGCACAAAGGTTCTTCCTCAACCCGTCGAGTCCTACCGCCACAAGGACAAGGGCCGATTCAACAAGT
GGCTCCAGACCGACGATAACTCGTGGACCTCCAAGAGCGTCTCCAAGGATGTCGACGATGGTTACGAGATCTCTGTCCCTGAGAACAAGATTCCCTCCAGGCGTGGTCCCTGGAAGACAT
GGACCAGCACGTTCAAGTGGTGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTTACTGTCCTCATTGCAGCTGCTCTGGCTGCTGCGCCTATCCCAGAGGCTGCTGCTCACCCTGGCATGGGAGAGACCATCAAGGAGATCGAACGAATTGCTGCTCGTAGCTGG
GGCAGCGGATGGGGTGGAAACAAGTGGCCAGGACAAGGCAACGGCGGCGGTTCGAGCTCGTGGCCTGGTCAGAGTAACGGCAATGGAGGCGGTTCCAGTTCTTGGCCTGGACAGACCAAC
AGTGGCGGTTCAAGCTCTTGGCCAGGACAGAGCAGTGGAAACGGAGGAGGATCTAGCTCATGGCCCGGCCAGAGCAACGGAGGTAGTGGCAGCGGCAGCAACAGCGGCAGTGGCTGGTCC
GGAGACAGCTTTGATGCCCACTCCCTCATCGGCGACCTTGCCACCCTCAGCGACAAGTCCCTCACTTCAGTCGGCAGTGACATCAAGAAGATCCTTCAAGGCAACGGCAACCCCACCAGC
CGCGAGCGCTACTTCGGCTGCCCTTCCATGAACTCTCAACGTTGCAAGCGTGATACCTGCTGTGTCTGGCAGTACATTTCCAACGAGCTGGAGGACAAGTTCAGGGGCGAGGCTGGCCGC
TGCACAAGATGGGCTCGATATGCTGTCCGCATCGGCTTTCACGATGCCGGCACCTGGTCTCTCAAGACCGCTTCCCAAGGCGGCGGTGCTGATGGCTCCATCATTCTCTCGAACGAGCTC
ACTCGTGGCGAGAACATGGGTCTTCAGCAGATTGGCGAGTACTACCAGACCATCTACGACAAGTACCACACACAGTATGGCTTCACCCAGGTCACCATGGCTGATCTGATCCAAATGGGC
TCCAATATTGCTGCCGTTACCTGCCCTCTCGGTCCCCGTGTCCGCTCTTTCGTTGGACGCAAGGATAGCACCAAGGCCAACCCCGGCGGTCTCCTGCCTAGCGTTAAATCTGATGCTCTC
ACTCTGATCAACCTCTTCAAGGACAAGACAATTGGCCCCGATGACCTTGTTGCCCTGATCGGTGCGCACACAACCTCTCAGCAGCATCACACCAACATTGATCGTGATGGCGACCCTCAG
GACAGTACTCCTGGTGTCTGGGATATCCTCTTCTACCAGCAAACCATTGATCAGGACGCACCCAAGCGTGTCTACAAGTTCCCCAGTGATGTGGCCCTCGCCAACCATCCTCTTACCCAG
CCTGCCTTTGAGGCCTTTGCCAGCGGCAGCACTGGCCAAGCTGCCTGGAATGTG
GACTATGCACGCGCCTATGTCCGTCTCAGTCTCTTGGGTGTCAACAATATCAACAGCCTCACCGAG
TGCACAAAGGTTCTTCCTCAACCCGTCGAGTCCTACCGCCACAAGGACAAGGGCCGATTCAACAAGTGGCTCCAGACCGACGATAACTCGTGGACCTCCAAGAGCGTCTCCAAGGATGTC
GACGATGGTTACGAGATCTCTGTCCCTGAGAACAAGATTCCCTCCAGGCGTGGTCCCTGGAAGACATGGACCAGCACGTTCAAGTGGTGGTAA

Retrieve as FASTA