Entry information : AbraCIIAA
Entry ID 6811
Creation 2009-05-18 (Christophe Dunand)
Last sequence changes 2012-04-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Christophe Dunand)
Peroxidase information: AbraCIIAA
Name AbraCIIAA
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Alternaria
Organism Alternaria brassicicola    [TaxId: 29001 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbraCIIAA
start..stop
S start..stop
AalteCIIAA01 766 0 1..404 1..404
COsaCIIAA05 750 0 1..404 1..404
SturCIIAA02 749 0 1..403 1..403
CheCIIAA05_C5 746 0 1..404 1..404
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3040077..3041066 990 N° 2 3039804..3040025 222  
complement(join(3039804..3040025,3040077..3041066))


exon

Literature and cross-references AbraCIIAA
DNA ref. JGI genome:   Contig1 (3041066..3039804)
Protein sequence: AbraCIIAA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   404 (383)
PWM (Da):   %s   44055.12 (41779.0)  
PI (pH):   %s   7.77 (7.83) Peptide Signal:   %s   cut: 21 range:21-403
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVFSYFSYALLACIPLTEAHRGMGGTRAEMRYLAAREKRQVSKELIGDLKTLADSKLTAIGKDVKAIILGQKTAESATIDGSIPVGNIGSTACKADMCCHWKWLAYEMTAKFNGTSGRCSKFARQAIRLGFHDAGVWSRSSGYGGADGSILLSDEMSRADNNGLAAIADQTTKW*NKYNQYGMSMADIIQFGANVATVVCPLGPRIRTFVGRKDNSKAGPSGLLPGEKDSADKLIKLFQDKTIDAHDLVALVGAHTTSQQHFVDTSRDGDPQDSTPGVWDMAFYPETTSNAPVRVIKFQSDINLSKDSRTKGSWAQFSDRATAQGRWNSDYAKAYTRLSLLGINNINDLKECTKVLPAERPNFVSEDQVLLDRWLNGEFDQLNNLVDDAIQLTGVISPREEKP

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 introns). Sequence contains a stop. Strain="ATCC 96836". No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGTTTTCTCTTACTTTAGCTATGCTCTCCTAGCATGTATTCCCCTTACTGAAGCTCATCGTGGAATGGGTGGCACGAGGGCTGAGATGCGTTACCTTGCTGCTCGCGAGAAGCGT
CAAGTCTCAAAAGAGCTCATCGGCGACCTCAAGACACTCGCAGATTCCAAGCTCACTGCCATCGGCAAAGACGTCAAAGCCATCATACTCGGCCAAAAGACTGCCGAGTCGGCTACCATA
GATGGCTCAATCCCTGTCGGCAACATCGGAAGCACTGCCTGCAAAGCTGATATGTGCTGCCACTGGAAGTGGCTTGCATACGAAATGACTGCCAAGTTCAATGGTACCTCTGGCCGATGC
AGCAAGTTTGCTCGTCAAGCCATTCGTCTGGGCTTCCACGATGCAGGCGTGTGGTCCAGAAGCAGTGGCTACGGTGGTGCGGATGGCAGTATTCTCCTCAGCGACGAGATGTCGCGTGCA
GACAATAATGGCCTTGCTGCGATTGCGGACCAAACAACGAAGTGGTAAAACAAATACAATCAATACGGCATGAGCATGGCGGATATCATTCAATTTGGCGCCAATGTCGCTACAGTAGTT
TGCCCGCTCGGACCAAGAATTCGAACCTTTGTTGGACGCAAAGACAACAGCAAGGCTGGCCCTAGTGGACTTCTTCCTGGGGAAAAGGATTCTGCAGATAAGCTCATTAAGCTCTTCCAA
GATAAGACTATAGATGCACACGATCTTGTTGCGCTCGTCGGAGCGCACACGACCTCGCAACAGCACTTCGTTGACACCAGTCGCGACGGTGACCCACAAGACTCTACTCCCGGTGTGTGG
GACATGGCCTTCTACCCCGAAACGACCAGTAATGCACCTGTTCGTGTCATCAAGTTCCAAAGCGACATCAACTTGAGTAAAGACTCACGGACAAAGGGTTCGTGGGCGCAGTTTAGCGAT
CGGGCTACTGCTCAGGGTCGATGGAACTCG
GTATGCTTTCACAGATTCCCAAAGCAATGTTTAGCTAACAAACGAATATAGGATTACGCAAAGGCTTACACGCGCTTATCTCTTCTCGGC
ATCAACAACATCAACGATCTCAAAGAATGCACCAAGGTCTTGCCCGCGGAACGGCCTAACTTTGTCAGCGAAGACCAGGTCTTACTCGATAGGTGGCTTAATGGCGAGTTTGATCAATTG
AACAACTTGGTGGATGATGCTATTCAACTGACCGGTGTAATATCTCCAAGAGAAGAGAAGCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGTTTTCTCTTACTTTAGCTATGCTCTCCTAGCATGTATTCCCCTTACTGAAGCTCATCGTGGAATGGGTGGCACGAGGGCTGAGATGCGTTACCTTGCTGCTCGCGAGAAGCGT
CAAGTCTCAAAAGAGCTCATCGGCGACCTCAAGACACTCGCAGATTCCAAGCTCACTGCCATCGGCAAAGACGTCAAAGCCATCATACTCGGCCAAAAGACTGCCGAGTCGGCTACCATA
GATGGCTCAATCCCTGTCGGCAACATCGGAAGCACTGCCTGCAAAGCTGATATGTGCTGCCACTGGAAGTGGCTTGCATACGAAATGACTGCCAAGTTCAATGGTACCTCTGGCCGATGC
AGCAAGTTTGCTCGTCAAGCCATTCGTCTGGGCTTCCACGATGCAGGCGTGTGGTCCAGAAGCAGTGGCTACGGTGGTGCGGATGGCAGTATTCTCCTCAGCGACGAGATGTCGCGTGCA
GACAATAATGGCCTTGCTGCGATTGCGGACCAAACAACGAAGTGGTAAAACAAATACAATCAATACGGCATGAGCATGGCGGATATCATTCAATTTGGCGCCAATGTCGCTACAGTAGTT
TGCCCGCTCGGACCAAGAATTCGAACCTTTGTTGGACGCAAAGACAACAGCAAGGCTGGCCCTAGTGGACTTCTTCCTGGGGAAAAGGATTCTGCAGATAAGCTCATTAAGCTCTTCCAA
GATAAGACTATAGATGCACACGATCTTGTTGCGCTCGTCGGAGCGCACACGACCTCGCAACAGCACTTCGTTGACACCAGTCGCGACGGTGACCCACAAGACTCTACTCCCGGTGTGTGG
GACATGGCCTTCTACCCCGAAACGACCAGTAATGCACCTGTTCGTGTCATCAAGTTCCAAAGCGACATCAACTTGAGTAAAGACTCACGGACAAAGGGTTCGTGGGCGCAGTTTAGCGAT
CGGGCTACTGCTCAGGGTCGATGGAACTCG
GATTACGCAAAGGCTTACACGCGCTTATCTCTTCTCGGCATCAACAACATCAACGATCTCAAAGAATGCACCAAGGTCTTGCCCGCGGAA
CGGCCTAACTTTGTCAGCGAAGACCAGGTCTTACTCGATAGGTGGCTTAATGGCGAGTTTGATCAATTGAACAACTTGGTGGATGATGCTATTCAACTGACCGGTGTAATATCTCCAAGA
GAAGAGAAGCCT

Retrieve as FASTA