Entry information : CheCIIAB02_C4
Entry ID 6817
Creation 2009-05-20 (Christophe Dunand)
Last sequence changes 2009-05-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-24 (Christophe Dunand)
Peroxidase information: CheCIIAB02_C4
Name CheCIIAB02_C4
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus heterostrophus    [TaxId: 5016 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CheCIIAB02_C4
start..stop
S start..stop
CheCIIAB02_C5 595 0 1..288 1..288
COsaCIIAB02 541 0 1..288 1..285
Ssrc1lsm3aCIIAB06 297 1e-101 3..279 2..278
ClunCIIAB02 289 3e-98 1..277 1..278
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1564132..1564806 675 N° 2 1564956..1565147 192  
join(1564132..1564806,1564956..1565147)


exon

Literature and cross-references CheCIIAB02_C4
DNA ref. JGI genome:   scaffold_3 (1564132..1565147)
mRNA ref. JGI transcript:   40363 (2613114..2614136) [Fragment]
Protein sequence: CheCIIAB02_C4
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   288 (268)
PWM (Da):   %s   31232.77 (29165.6)  
PI (pH):   %s   7.74 (7.06) Peptide Signal:   %s   cut: 21 range:21-288
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRPTISLALAVLTATTRISALNLLPRQSACPSVWTDVAASFKKRLTSCGQFAHTLIRLAFHDCHSGCDGSILLTNECSYTQNRGLNDTCNTLRSMRTQFNVGAADIIQFGAALAIAACPLGPRVQALVGRPDSTQAAPVGSLPHSSDSPEKLVADFRAIGISAQEMIALLGTHSVAVQLFDDPKQAGKSLDSTPSTYDTLYYNQTKFRTAPYTLQSDFELAHYNETADIWDSFINSADLWNQVFVPAWFKLSTVGVDTSNLQDCSDLVPASKTKRRKSVDGVVRKFRG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCCCACCATATCCTTAGCCCTGGCCGTCCTCACGGCAACAACGCGCATCTCAGCCCTCAACCTCCTCCCACGCCAGAGCGCCTGTCCCTCAGTCTGGACCGACGTCGCCGCCTCC
TTCAAAAAACGACTAACCAGCTGCGGCCAATTCGCCCATACCCTCATCCGCCTCGCCTTCCACGACTGCCACTCAGGCTGCGACGGCAGCATCCTCCTCACCAACGAATGCTCTTACACC
CAAAACCGCGGCCTCAACGACACATGCAACACGCTCCGCAGCATGCGCACCCAATTCAACGTCGGCGCCGCCGACATCATCCAATTCGGCGCCGCCCTCGCCATCGCCGCCTGCCCGCTG
GGGCCCCGGGTACAAGCCTTGGTGGGCCGCCCCGACAGCACCCAAGCCGCGCCTGTGGGCTCCCTCCCGCACAGCAGCGACTCGCCCGAGAAGCTGGTTGCGGATTTCCGCGCCATAGGC
ATCTCGGCGCAGGAAATGATTGCGCTGCTCGGCACGCATAGTGTCGCCGTGCAGCTGTTTGATGACCCGAAACAGGCGGGCAAGTCGCTCGATAGTACCCCCTCGACGTATGACACTTTG
TACTATAATCAGACCAAGTTTCGGACTGCGCCGTATACGCTGCAGAGTGATTTTGAGCTCGCGCATTATAATGAG
GTGTGTGTTTGTGCTCTCTCTTTTCCCTTCTTCCCCCCCCTCACC
TCCCCCCTTTTTTTCCTATGTTATCTTTCCCCTTTCGCTACTTTAAGGGTTTTTTTTTCGCTATAGAAAGAGGATGAAATGTTGACGTGAATGTTGAAATCTAGACGGCAGATATTTGGG
ACTCGTTTATTAACTCGGCGGATCTGTGGAATCAAGTTTTTGTCCCCGCGTGGTTCAAGTTGTCGACTGTGGGGGTAGACACGAGTAATTTGCAGGATTGCTCGGATCTTGTTCCAGCCA
GCAAGACGAAACGTCGTAAGAGCGTGGATGGAGTAGTGAGGAAGTTTAGGGGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCCCACCATATCCTTAGCCCTGGCCGTCCTCACGGCAACAACGCGCATCTCAGCCCTCAACCTCCTCCCACGCCAGAGCGCCTGTCCCTCAGTCTGGACCGACGTCGCCGCCTCC
TTCAAAAAACGACTAACCAGCTGCGGCCAATTCGCCCATACCCTCATCCGCCTCGCCTTCCACGACTGCCACTCAGGCTGCGACGGCAGCATCCTCCTCACCAACGAATGCTCTTACACC
CAAAACCGCGGCCTCAACGACACATGCAACACGCTCCGCAGCATGCGCACCCAATTCAACGTCGGCGCCGCCGACATCATCCAATTCGGCGCCGCCCTCGCCATCGCCGCCTGCCCGCTG
GGGCCCCGGGTACAAGCCTTGGTGGGCCGCCCCGACAGCACCCAAGCCGCGCCTGTGGGCTCCCTCCCGCACAGCAGCGACTCGCCCGAGAAGCTGGTTGCGGATTTCCGCGCCATAGGC
ATCTCGGCGCAGGAAATGATTGCGCTGCTCGGCACGCATAGTGTCGCCGTGCAGCTGTTTGATGACCCGAAACAGGCGGGCAAGTCGCTCGATAGTACCCCCTCGACGTATGACACTTTG
TACTATAATCAGACCAAGTTTCGGACTGCGCCGTATACGCTGCAGAGTGATTTTGAGCTCGCGCATTATAATGAG
ACGGCAGATATTTGGGACTCGTTTATTAACTCGGCGGATCTGTGG
AATCAAGTTTTTGTCCCCGCGTGGTTCAAGTTGTCGACTGTGGGGGTAGACACGAGTAATTTGCAGGATTGCTCGGATCTTGTTCCAGCCAGCAAGACGAAACGTCGTAAGAGCGTGGAT
GGAGTAGTGAGGAAGTTTAGGGGGTGA

Retrieve as FASTA