Entry information : CparCIIAB01
Entry ID 6821
Creation 2009-05-20 (Christophe Dunand)
Last sequence changes 2011-10-17 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-11-29 (Christophe Dunand)
Peroxidase information: CparCIIAB01
Name CparCIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Cryphonectriaceae Cryphonectria
Organism Cryphonectria parasitica    [TaxId: 5116 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CparCIIAB01
start..stop
S start..stop
MEspCIIAB01_NRRL54901 236 2e-77 49..282 20..264
DescCIIAB01 200 1e-63 49..282 24..270
HEC38CIIAB01 197 2e-62 49..282 24..266
HC14CIIAB01 190 9e-60 49..282 24..266
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 657221..657629 409 N° 2 657723..658083 361 N° 3 658221..658332 112  
join(657221..657629,657723..658083,658221..658332)


exon

Literature and cross-references CparCIIAB01
DNA ref. JGI genome:   scaffold_5 (657221..658332)
Protein sequence: CparCIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   293 (271)
PWM (Da):   %s   32022.46 (29772.1)  
PI (pH):   %s   4.37 (4.31) Peptide Signal:   %s   cut: 23 range:23-293
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSLVSLRLLLLTGLLLAGAMAQCHRDGHPGGGPGYGPPCGPPDNYPVCEEVWKYIAKELKHYFIDDHGECTQLAAQAVRLPLHDCFPDGGCDGSIILTDECSRPENWQMLSICGVLYKMYKDYRVGAADLINFAGSIANKACPWGPFIPFYVGRHDNPTPAPEYQMPGAYSNASTLIAEFAARGFSVTDLVALVGAHSVGGDLWRKPFDTTPGVMDSPTYYTEVLVGNAPSILYSDKSLALDPASTDDWQLYARDHMIKMILLEVDPRTVQDCSEVIWDAFEGDWESLQDTE

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Position of intron 2 is suspicious: conserved W is missing between LYARD and HMIKMI (Q*AWDVAY is found in frame with LYARD!!!). No EST. Incorrect prediction from JGI (last exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTCTCTTGTTTCTCTGCGACTACTCCTCCTCACCGGCCTCCTGCTCGCTGGAGCCATGGCCCAGTGTCATCGAGACGGCCATCCTGGCGGTGGCCCTGGCTATGGTCCTCCCTGT
GGGCCCCCAGATAACTACCCGGTGTGCGAGGAAGTCTGGAAGTACATCGCAAAGGAGCTCAAACACTACTTCATCGACGATCATGGCGAGTGCACCCAGCTGGCTGCTCAGGCTGTTCGG
CTGCCCCTCCACGACTGCTTCCCTGATGGCGGCTGCGACGGGTCCATCATCCTCACCGACGAGTGTTCCCGCCCGGAGAACTGGCAAATGCTTTCCATCTGTGGTGTTCTATACAAAATG
TACAAGGACTATCGTGTCGGTGCCGCTGACCTAATCAATTTTGCTGGCT
GTGAGTTCATGATTTCTTTCCGTTCCATTCTATCCCCCTCTCGTTCACTGCTGCATTGGTAGCGCAAAGAG
TTCCGTTACTGACACAGCCCAGCTATCGCCAACAAGGCCTGCCCCTGGGGGCCCTTCATCCCATTCTATGTCGGACGACATGACAACCCAACTCCAGCTCCTGAGTACCAAATGCCAGGC
GCCTACTCCAATGCCTCGACCTTGATTGCAGAGTTTGCCGCCAGGGGTTTCTCGGTCACAGACCTTGTTGCGCTGGTGGGTGCGCATAGTGTTGGCGGCGATTTGTGGCGGAAGCCATTC
GATACCACGCCTGGCGTCATGGATAGTCCAACGTACTATACCGAGGTGCTGGTCGGCAATGCGCCTTCCATCCTGTACAGTGACAAGTCTCTGGCCCTGGATCCTGCTTCGACCGACGAT
TGGCAATTGTATGCTCGTGATCA
GTAGGCCTGGGACGTGGCTTATGTCAATGCGTGAGTCTGGCTTTCTTCTGCACTGCCCCTGCTCTTTGCTCGCGTTTGCGCGACTTTAGACATATCT
TCGTATTGGCTGAAGATGGCCGATGCTGACTGTGTCGTAGCATGATCAAGATGATCCTTCTGGAGGTTGATCCGCGGACGGTGCAAGATTGCTCAGAAGTCATCTGGGATGCGTTCGAGG
GAGACTGGGAGTCTCTGCAAGATACGGAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTCTCTTGTTTCTCTGCGACTACTCCTCCTCACCGGCCTCCTGCTCGCTGGAGCCATGGCCCAGTGTCATCGAGACGGCCATCCTGGCGGTGGCCCTGGCTATGGTCCTCCCTGT
GGGCCCCCAGATAACTACCCGGTGTGCGAGGAAGTCTGGAAGTACATCGCAAAGGAGCTCAAACACTACTTCATCGACGATCATGGCGAGTGCACCCAGCTGGCTGCTCAGGCTGTTCGG
CTGCCCCTCCACGACTGCTTCCCTGATGGCGGCTGCGACGGGTCCATCATCCTCACCGACGAGTGTTCCCGCCCGGAGAACTGGCAAATGCTTTCCATCTGTGGTGTTCTATACAAAATG
TACAAGGACTATCGTGTCGGTGCCGCTGACCTAATCAATTTTGCTGGCT
CTATCGCCAACAAGGCCTGCCCCTGGGGGCCCTTCATCCCATTCTATGTCGGACGACATGACAACCCAACT
CCAGCTCCTGAGTACCAAATGCCAGGCGCCTACTCCAATGCCTCGACCTTGATTGCAGAGTTTGCCGCCAGGGGTTTCTCGGTCACAGACCTTGTTGCGCTGGTGGGTGCGCATAGTGTT
GGCGGCGATTTGTGGCGGAAGCCATTCGATACCACGCCTGGCGTCATGGATAGTCCAACGTACTATACCGAGGTGCTGGTCGGCAATGCGCCTTCCATCCTGTACAGTGACAAGTCTCTG
GCCCTGGATCCTGCTTCGACCGACGATTGGCAATTGTATGCTCGTGATCA
CATGATCAAGATGATCCTTCTGGAGGTTGATCCGCGGACGGTGCAAGATTGCTCAGAAGTCATCTGGGAT
GCGTTCGAGGGAGACTGGGAGTCTCTGCAAGATACGGAATGA

Retrieve as FASTA