Entry information : AbraCIIAB03
Entry ID 6828
Creation 2009-05-22 (Christophe Dunand)
Last sequence changes 2009-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AbraCIIAB03
Name AbraCIIAB03
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Alternaria
Organism Alternaria brassicicola    [TaxId: 29001 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbraCIIAB03
start..stop
S start..stop
AalteCIIAB01 517 0 1..293 1..293
Ssrc1lsm3aCIIAB06 431 3e-154 1..277 1..276
ClunCIIAB02 431 6e-154 4..293 5..294
PtritCIIAB04 405 9e-144 1..293 1..292
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1176163..1176837 675 N° 2 1175881..1176090 210  
complement(join(1175881..1176090,1176163..1176837))


exon

Literature and cross-references AbraCIIAB03
DNA ref. JGI genome:   Contig3 (1176837..1175881)
Protein sequence: AbraCIIAB03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   294 (276)
PWM (Da):   %s   30815.1 (29025.1)  
PI (pH):   %s   7.24 (6.73) Peptide Signal:   %s   cut: 19 range:19-294
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSFAIVLVALAATSTSAFNIWPRASSKCPAVWSDVASELESDFAGCGGAAHAAIRAPFHDCINNGCDGSLILTSECSRPENAGLSSICKKLKGWSDKYKVTAADMIQFAAATAISVCPLGPRVQALVGRKDSSKAAAVGSVPASRDSLNSILRAFSAKGFSADDVVALMGTHSVALQFNDDPSQAGKGLDSTPGAYDNTFYKETKDGTAPYSLQSDVLLSNSSQTADTWSSFADDADAWISAFTEAWNRFSVIGSDAGKLQDCSSLIPSSSASKKRQAFNAKFTKMMSAKFRS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTCCTTCGCCATTGTCCTCGTCGCTCTGGCGGCGACCTCGACATCGGCCTTCAACATCTGGCCTCGCGCATCCTCCAAATGTCCCGCCGTCTGGTCCGATGTCGCCTCCGAACTT
GAGTCTGACTTTGCTGGTTGTGGAGGGGCTGCTCATGCAGCCATCCGTGCACCCTTCCATGACTGCATCAACAACGGCTGCGACGGTAGTCTGATCCTCACAAGCGAATGCTCGCGGCCC
GAAAACGCCGGCCTCTCTAGCATATGCAAGAAGCTCAAAGGCTGGAGCGACAAGTACAAAGTCACTGCAGCCGACATGATCCAATTTGCCGCCGCAACAGCAATCTCAGTGTGTCCGCTT
GGCCCCAGGGTTCAAGCACTGGTTGGTCGCAAAGACAGCTCCAAGGCTGCGGCTGTTGGAAGTGTGCCAGCAAGTCGCGATTCCTTGAACAGCATCTTGAGAGCGTTCAGCGCAAAGGGG
TTTTCGGCCGATGATGTCGTTGCACTCATGGGTACGCATAGTGTAGCACTGCAGTTCAACGACGACCCATCGCAGGCTGGAAAAGGGTTGGACTCGACACCAGGCGCGTACGACAATACC
TTCTACAAGGAGACCAAGGACGGTACAGCGCCATACAGTCTGCAAAGCGATGTTCTCCTCTCCAACTCGTCTCAG
GTACGTCTCGACCATGATTCGTCTTGACCTTTGACAGATTATTAA
TTTTATTTTATTTTTTCGCTTGCGCAGACAGCAGACACATGGTCTTCCTTTGCCGATGACGCCGACGCCTGGATCAGCGCCTTTACAGAGGCGTGGAACCGATTTTCTGTTATTGGAAGT
GATGCGGGTAAGCTCCAAGACTGCTCGAGCTTGATCCCTAGTAGCAGTGCGAGCAAGAAGAGGCAGGCGTTTAATGCAAAGTTCACCAAGATGATGAGCGCGAAATTCAGGTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTCCTTCGCCATTGTCCTCGTCGCTCTGGCGGCGACCTCGACATCGGCCTTCAACATCTGGCCTCGCGCATCCTCCAAATGTCCCGCCGTCTGGTCCGATGTCGCCTCCGAACTT
GAGTCTGACTTTGCTGGTTGTGGAGGGGCTGCTCATGCAGCCATCCGTGCACCCTTCCATGACTGCATCAACAACGGCTGCGACGGTAGTCTGATCCTCACAAGCGAATGCTCGCGGCCC
GAAAACGCCGGCCTCTCTAGCATATGCAAGAAGCTCAAAGGCTGGAGCGACAAGTACAAAGTCACTGCAGCCGACATGATCCAATTTGCCGCCGCAACAGCAATCTCAGTGTGTCCGCTT
GGCCCCAGGGTTCAAGCACTGGTTGGTCGCAAAGACAGCTCCAAGGCTGCGGCTGTTGGAAGTGTGCCAGCAAGTCGCGATTCCTTGAACAGCATCTTGAGAGCGTTCAGCGCAAAGGGG
TTTTCGGCCGATGATGTCGTTGCACTCATGGGTACGCATAGTGTAGCACTGCAGTTCAACGACGACCCATCGCAGGCTGGAAAAGGGTTGGACTCGACACCAGGCGCGTACGACAATACC
TTCTACAAGGAGACCAAGGACGGTACAGCGCCATACAGTCTGCAAAGCGATGTTCTCCTCTCCAACTCGTCTCAG
ACAGCAGACACATGGTCTTCCTTTGCCGATGACGCCGACGCCTGG
ATCAGCGCCTTTACAGAGGCGTGGAACCGATTTTCTGTTATTGGAAGTGATGCGGGTAAGCTCCAAGACTGCTCGAGCTTGATCCCTAGTAGCAGTGCGAGCAAGAAGAGGCAGGCGTTT
AATGCAAAGTTCACCAAGATGATGAGCGCGAAATTCAGGTCGTGA

Retrieve as FASTA