Entry information : AbraCIIAB01
Entry ID 6829
Creation 2009-05-22 (Christophe Dunand)
Last sequence changes 2012-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-02-14 (Nizar Fawal)
Peroxidase information: AbraCIIAB01
Name AbraCIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Alternaria
Organism Alternaria brassicicola    [TaxId: 29001 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbraCIIAB01
start..stop
S start..stop
AalteCIIAB02 610 0 1..327 1..327
PterCIIAB01 486 2e-174 1..327 1..335
PtritCIIAB01 476 8e-171 1..327 1..333
CberCIIAB01 459 2e-164 1..327 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1651370..1651955 586 N° 2 1650918..1651315 398  
complement(join(1650918..1651315,1651370..1651955))


exon

Literature and cross-references AbraCIIAB01
DNA ref. GenBank:   ACIW01001729.1 (2087..1050) JGI genome:   Contig5 (1651955..1650918)
Cluster/Prediction ref. JGI gene:   5965
Protein sequence: AbraCIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (308)
PWM (Da):   %s   34757.79 (32584.6)  
PI (pH):   %s   9.09 (8.74) Peptide Signal:   %s   cut: 20 range:20-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYIRNVLLSGLAAVSTVQAYANYTIREEDWTVAPPAPVQEKRTLGKIIGLVGGLFGGNKEPAQKCPAVWTQISSTLTQQFLGDGQCTDAARAAIRSSFHDCFNGACDGSLILANECSNKENRGLERLCSNLANVASQTKVGVADLIQFAAAHAVKTCPGGPTIPVKVGRKDSSEANALGVLPNGFVKGEDLVRLFASKGFSPYDLAALIGAHTAAKQRVTDPSKAGAGLDSTVGTWDNKFYSETKRGKAPFTLESDKSIAQNPLTAIPFSTFAASKGLWDSAFVGAMVKMSMLGVEDKNLIDCTSALPGGSKRRDVKRSNLFDRLKW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAATGTTCTCCTCTCTGGCCTTGCGGCTGTCAGCACAGTCCAAGCTTACGCCAACTATACCATCCGGGAAGAAGATTGGACCGTAGCGCCGCCAGCACCGGTACAAGAG
AAACGTACTCTGGGAAAGATCATTGGTCTAGTTGGTGGCCTCTTCGGTGGCAACAAGGAACCTGCACAGAAATGTCCTGCTGTCTGGACTCAAATCTCTTCCACCCTCACCCAGCAATTC
CTCGGAGATGGCCAGTGCACAGATGCTGCCCGCGCTGCTATCCGATCTTCCTTCCATGACTGCTTCAACGGAGCTTGCGACGGATCCCTCATCCTCGCCAATGAGTGCTCGAACAAAGAG
AACCGCGGTCTGGAGCGCCTTTGCAGTAACCTCGCCAATGTTGCCTCCCAGACCAAGGTCGGCGTTGCCGATCTCATCCAGTTTGCGGCCGCACACGCAGTCAAGACATGCCCTGGTGGA
CCTACCATTCCCGTCAAGGTTGGTCGCAAAGATTCAAGTGAGGCAAACGCCCTCGGTGTTCTACCCAACGGTTTCGTCAAGGGAGAAGATTTAGTCAGGCTCTTCG
GTAAGCTTCCGTCT
TTCAACTCATAACCTTCAACATAGCTAACAAAATTCTTAGCATCCAAAGGCTTCTCTCCCTATGACCTTGCTGCTCTAATCGGCGCCCACACTGCCGCCAAACAACGAGTCACCGACCCT
TCCAAAGCCGGTGCTGGACTTGACTCTACTGTCGGCACCTGGGACAACAAATTCTACTCCGAGACCAAGCGTGGCAAGGCCCCCTTCACACTCGAGTCTGACAAGAGCATTGCGCAGAAC
CCTCTTACCGCAATCCCCTTTTCAACATTTGCCGCCAGCAAGGGTTTGTGGGATTCGGCATTCGTAGGCGCAATGGTCAAGATGAGCATGCTTGGTGTTGAGGACAAGAACTTGATCGAC
TGCACCAGTGCGCTACCTGGTGGCAGCAAAAGGAGGGATGTCAAGAGAAGTAACCTTTTCGACCGCCTCAAGTGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAATGTTCTCCTCTCTGGCCTTGCGGCTGTCAGCACAGTCCAAGCTTACGCCAACTATACCATCCGGGAAGAAGATTGGACCGTAGCGCCGCCAGCACCGGTACAAGAG
AAACGTACTCTGGGAAAGATCATTGGTCTAGTTGGTGGCCTCTTCGGTGGCAACAAGGAACCTGCACAGAAATGTCCTGCTGTCTGGACTCAAATCTCTTCCACCCTCACCCAGCAATTC
CTCGGAGATGGCCAGTGCACAGATGCTGCCCGCGCTGCTATCCGATCTTCCTTCCATGACTGCTTCAACGGAGCTTGCGACGGATCCCTCATCCTCGCCAATGAGTGCTCGAACAAAGAG
AACCGCGGTCTGGAGCGCCTTTGCAGTAACCTCGCCAATGTTGCCTCCCAGACCAAGGTCGGCGTTGCCGATCTCATCCAGTTTGCGGCCGCACACGCAGTCAAGACATGCCCTGGTGGA
CCTACCATTCCCGTCAAGGTTGGTCGCAAAGATTCAAGTGAGGCAAACGCCCTCGGTGTTCTACCCAACGGTTTCGTCAAGGGAGAAGATTTAGTCAGGCTCTTCG
CATCCAAAGGCTTC
TCTCCCTATGACCTTGCTGCTCTAATCGGCGCCCACACTGCCGCCAAACAACGAGTCACCGACCCTTCCAAAGCCGGTGCTGGACTTGACTCTACTGTCGGCACCTGGGACAACAAATTC
TACTCCGAGACCAAGCGTGGCAAGGCCCCCTTCACACTCGAGTCTGACAAGAGCATTGCGCAGAACCCTCTTACCGCAATCCCCTTTTCAACATTTGCCGCCAGCAAGGGTTTGTGGGAT
TCGGCATTCGTAGGCGCAATGGTCAAGATGAGCATGCTTGGTGTTGAGGACAAGAACTTGATCGACTGCACCAGTGCGCTACCTGGTGGCAGCAAAAGGAGGGATGTCAAGAGAAGTAAC
CTTTTCGACCGCCTCAAGTGGTAG

Retrieve as FASTA